KEGG   Pyrenophora teres: PTT_09432Help
Entry
PTT_09432         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K19785  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
pte  Pyrenophora teres
Pathway
pte00760  Nicotinate and nicotinamide metabolism
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PTT_09432
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     PTT_09432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: EFQ93237
UniProt: E3RM03
Position
Unknown
AA seq 309 aa AA seqDB search
MADMTWRIASLRALLPDLESALHSFTSSAAKFRVVRTVNSTTTQPKTLYILDSSFNPPSI
AHLTLATSALKQSVASEQSPYRLLLLFSTHNADKAPSPASFVQRLALMTMFAEDLSQSLK
TAEPPLSPDVSTISIDIGLTKEPYYSDKSAAIANATPPVYPSKPIHVHLVGYDTLIRFCN
PKYYPKHHPPLSALKPFFDANHKLRVTQRPADASDESSNDFGTTEEQARYLHDLKLGKQE
EAGFAPTWGNNIEMVQAEEGVGVSSTRVRKAAKEGQWETVDQLCTKSVAAWIKDQALYSE
DASGKKMMS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatgacatggcgcatcgcatcgctgagggcgctgttaccagacctcgaatcg
gcactgcattcatttacaagttcggccgcaaaatttcgcgtggtgcgcacagtcaacagc
accacgacgcagcccaagacgctctacattctcgactcttccttcaacccaccgtccatt
gcccacctcaccctcgccacatcggcgttgaagcaatctgtagcgtcagagcagagtccg
tacaggctgctcttgctgtttagcacgcacaatgcagacaaggcaccgagtcccgcaagc
ttcgtgcagcgacttgccttgatgaccatgtttgcagaggacctgtcgcagagcctcaag
acggccgagccccctctgagccctgatgtctccactatctccatagacattggtctcact
aaagagccctactacagtgacaagtcggctgccattgccaatgccacgccgcccgtatat
ccgtccaagccaattcatgtccatcttgtcggctatgacaccctaatccgtttctgcaac
ccaaagtactacccgaagcaccatccacctctctcggccctgaagcccttctttgacgcc
aaccacaagctacgcgtcacccagcgaccggccgacgcgagcgacgagtcctccaacgac
tttggcacaacagaggagcaggcaaggtacctgcatgacctgaagcttggaaagcaggaa
gaagcagggtttgcgccgacatggggcaacaatatcgaaatggtgcaggctgaagaaggt
gtgggcgtaagctcaacgcgagtgcgaaaagctgccaaggagggccaatgggaaacagtc
gaccagctgtgtaccaaaagtgtggctgcgtggatcaaagaccaggcactgtacagcgaa
gatgcaagtggcaagaagatgatgagctga

DBGET integrated database retrieval system