KEGG   Pyrenophora teres: PTT_09481Help
Entry
PTT_09481         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pte  Pyrenophora teres
Pathway
pte00670  One carbon pool by folate
pte01100  Metabolic pathways
pte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PTT_09481
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PTT_09481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: EFQ93205
UniProt: E3RM42
Position
Unknown
AA seq 651 aa AA seqDB search
MHISKKLAQAREEGKPTFSFEFFPPKTAQGVQNLYDRMDRMHGFGPQFIDLTWGAGGRHS
KLTCEMVKVAQTVYGLETCMHLTCTDMEKSKLDDALREAYQSGCTNILALRGDPPREREK
WEATAGGFRYAKDLVVYIKEKYGNHFDIGVAGYSEGSDDNDNVDELIDHLKEKVDAGGTF
IVTQMFYDVDLFLEWVGKVRAKGIDVPIIPGIMPIHTHAAFLRRAQWTRCNIPQHWTDAL
EPVKNDDVEVREVGKILVADMCRKLIAAGITHLHFYTMNLAQATRMVLEELDLLPDGEAP
LEKPLPWRPSLGLNRRDENVRPIFWRNRNRSYVARTQDWDEFPNGRWGDSRSPAFGELDS
YGIGLKGTNEQNVKLWGTPMCIRDLSDLFVRYMEGKLDSLPWSEQAITTEAGPIRSDLID
LNRRGFLTINSQPAVNGAKSSDPVFGWGPRNGYVYQKAYLEVFVSPEYISEIITRLERDP
EFTYYAVNKDGDLKTNAPNEGPNAVTWGVFPGKEIVQPTIVETVSFLAWKDEFYRLGQQW
ANCHAGVSPSRYVIQDFVDTWYLLNIVHNDFRETRGIFPIFDGLEVKDMDKPLYNPSVDL
PGVNGSEATNGTNVTNGEAEPHKKEAPGLIETAKAAAVEVTNGIKSLAVSN
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcacatctccaagaaactcgcccaggcgagggaggagggaaagccaaccttctccttt
gagttcttcccgccaaagaccgcacagggagtccaaaacctctacgaccgcatggaccgc
atgcatggcttcggtccacagttcatcgatcttacctggggtgcgggcggccgccactcc
aagttgacatgcgagatggtcaaggtcgcccaaaccgtctacggtctcgagacgtgcatg
catctcacatgtaccgacatggagaagtccaagctcgacgacgcccttcgcgaggcctat
caatccggctgcacaaacattcttgccctgaggggagacccgccgcgtgaaagagaaaag
tgggaagcaactgctggcggcttccgctatgcaaaggatctggtcgtatacatcaaggag
aaatacggaaaccacttcgacataggtgtggcaggatactcagaggggagcgatgacaat
gacaatgtcgacgagctcatcgaccacttgaaggagaaggtcgatgccggaggaaccttc
atcgtaacccagatgttctacgatgtcgacctttttctcgagtgggtgggcaaggttcgt
gcaaagggcattgacgttcccattatccccggtattatgcccatccacacccacgcagcc
ttcctacgaagagcacagtggaccaggtgcaacatcccacaacattggaccgatgccctt
gagcctgtaaagaacgacgatgtcgaagtgcgtgaagtcggaaagatcctggtcgccgac
atgtgccggaagctgattgctgctggtatcacgcatctgcatttttacacgatgaacctt
gcacaggccacgcgtatggtcctcgaagagctagatcttctaccagacggcgaggcgcca
ttggagaagcctctcccctggcgaccctctttgggcctcaaccgacgcgacgagaacgta
cgtcccattttctggcgcaaccgcaatcgatcctacgtcgcacgcacacaagactgggac
gagtttcctaacggccgctggggagattcgcgctctccggcctttggtgaattggactct
tacggcatcggtctgaagggcaccaacgagcagaacgtaaagctatggggcacacccatg
tgtatcagagatctttccgatctctttgtgcgttacatggaaggaaaactggattctttg
ccctggagcgaacaggccatcacgaccgaagccgggcccattcggagtgacctgattgat
ttgaaccgtcgcgggttcctaaccatcaactcacaacctgcggtcaacggtgccaagtct
tcggatccagtgtttggctggggtccacgcaacggctacgtctaccaaaaggcgtacctg
gaggtctttgtctctccggaatacatctccgagatcatcacccgtcttgagcgcgatccc
gagttcacatactatgcagtgaacaaggatggggacctgaagacaaacgctcccaacgaa
ggacccaatgccgtaacatggggtgtcttcccgggcaaggaaatcgtacagccgaccatt
gtcgagacggtcagcttcctcgcttggaaggacgagttctaccgcctcggtcagcagtgg
gcgaactgccatgctggtgtaagcccttcgcgttacgtcattcaggactttgtggacaca
tggtacctgctcaatattgtacataacgacttccgcgaaacccgtggcatcttccccatc
ttcgacggcctagaggtcaaggacatggataagccactgtataaccctagcgttgacctt
cctggagtcaacggtagtgaggcgacaaacggaaccaatgtcacgaatggcgaagctgaa
ccccacaagaaagaagccccaggcttgatcgaaaccgccaaagcagcagctgttgaggtc
acgaatggcataaagagcctggccgtctccaactaa

DBGET integrated database retrieval system