KEGG   Pyrenophora teres: PTT_10954Help
Entry
PTT_10954         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pte  Pyrenophora teres
Pathway
pte00052  Galactose metabolism
pte00500  Starch and sucrose metabolism
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PTT_10954
   00500 Starch and sucrose metabolism
    PTT_10954
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PTT_10954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N E1_dh
Motif
Other DBs
NCBI-ProteinID: EFQ92034
UniProt: E3RQG1
Position
Unknown
AA seq 629 aa AA seqDB search
MKITSSVLVSFAGLASSHIIPRQGSIDYNVAPPNLSILANASLFKIWRPKAHVLPTYGQI
GDPCMHYTDPKTGIFHVGYLHDGASGATTSNLVTYSDLNPNSEPFIRAGGLNDPLYVFDG
SVIERGINGTPTLLYTSVSYLPIQWTVRYTKGSETQSLAVATDGGRNFTKSNIGPVIPSP
PFAVNVTGFRDPYVFQNTQVDSLLGKRDGTWYTVISGGVHGKGPSLFLYAQYEDEDADLF
QTWEYLGEWWHEQANTTWTEEGWAGRWGFNFEVANYFALDKHGANPKGEIFVTVGAEWSY
TPIVPQVSDNRDMLWAAGKQTLVNGKLTFEPTMAGKLDSGRSAYAAAGKVLPADSQASWS
SGAPDRFITYVWLTGDFYGTAKQFPTAQQNWTGSLLLPRELSVGYLNVIDNELSREKGAW
RIDCENTNGTLTLATLHQKIAREPYAAFTKNATGTITQSGGKVSQTTRFKTSPMSKHYML
SASLTFPSRSESLKAGFKILTGAHESTPIYYQFSNESFIVDRSNSSAAAATTSGIANDNE
TGKFRLFDIASGNGTRVETLDLTIVVDGGVVEVHANNRFALSTWVRSWYGDSTGIEFFVE
GGEVTFSEVKVWEGLVDAWPQRKSVVQSA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcacatcatcagttttggtgtcttttgccggattagcatcaagtcacatcatt
cctcgtcaaggatcaatcgattataatgtggctccgccaaacctttccatcctagctaat
gcatctctgttcaaaatatggcgaccaaaagcgcacgttcttccgacatatggtcagata
ggcgacccatgcatgcactatactgaccccaaaactggcatcttccacgtaggatacctc
catgatggcgcatcaggtgcaacaacaagcaacctagttacctacagcgacttgaatccc
aactctgagccatttattcgcgcaggcggcctcaacgatcccctctatgtgttcgacggc
agtgtaattgagcgcggaattaatggtacaccaaccctactgtacaccagcgtgagctac
ctacccattcaatggaccgtccgttatacaaaaggaagcgaaacgcaatccctagccgtg
gccacagatggaggaagaaactttaccaagtccaatattggcccagtaatccctagcccg
ccctttgctgtaaacgtcacggggttcagagacccatatgttttccagaacacacaagtc
gacagcttgttaggaaagcgggatgggacttggtataccgtcatttctggcggtgtgcat
ggcaaaggcccaagcttgtttttatacgctcaatacgaagatgaagatgccgatctgttc
cagacatgggagtatctgggcgaatggtggcatgaacaagcaaatacgacctggactgaa
gagggttgggccggacgctggggtttcaattttgaagttgcaaactactttgcactggac
aagcacggggctaacccaaagggtgaaatttttgtcaccgtgggtgcggagtggagttat
acacccatcgtcccgcaagtctcggacaacagagatatgctctgggccgctggaaagcaa
acactcgtgaacggaaaattgacatttgagcccaccatggctggaaaactagattccgga
cgctcagcgtatgcagcagctggtaaagttctgcccgcagactcgcaagctagctggtca
agcggcgcacccgatcgtttcatcacatacgtatggctaacaggcgacttctacggaacc
gcaaaacaattccctaccgcgcagcaaaactggactggctccttgcttctcccccgcgaa
ctcagcgtcggctacctgaacgtcatcgacaacgaactttcacgggagaagggggcatgg
agaatcgactgcgagaacactaacggtaccctcacactagcgacactgcaccagaagatc
gccagagaaccttatgctgcgtttacaaagaacgcgactggcaccatcacgcagtctggt
ggaaaggtttcccagacgaccaggttcaagacaagtccaatgtcgaagcattacatgttg
tccgccagtttgaccttcccatcgcgctcagaatccctgaaagctggcttcaagatcctc
acaggagcacacgagtcaacacctatttactaccaattctccaatgaaagcttcatcgtc
gatcgctcaaactcttctgccgcggcggcgactacatccggtatcgccaacgacaatgag
acgggaaagttccgcttgtttgatattgctagcggcaatggtacacgggttgagacgctg
gatttgacgattgtggtagatgggggtgtggtagaggttcatgctaacaatcggtttgcg
ttgagcacttgggtaagaagctggtatggggatagtacaggtattgagttctttgtggag
ggcggcgaagttactttcagcgaggtcaaggtttgggaggggctcgttgatgcatggccg
cagcgtaagagcgttgttcaaagcgcataa

DBGET integrated database retrieval system