KEGG   Pyrenophora teres: PTT_11027Help
Entry
PTT_11027         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Pathway
pte04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PTT_11027
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PTT_11027
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PTT_11027
Membrane trafficking [BR:pte04131]
 Endosome - Lysosome transport
  Others
   Others
    PTT_11027
Ubiquitin system [BR:pte04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PTT_11027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Rhodanese
Motif
Other DBs
NCBI-ProteinID: EFQ91982
UniProt: E3RQL5
Position
Unknown
AA seq 984 aa AA seqDB search
MSAAAPQPPSGHLPGNTMNGFPNGAQSAGSDGSSRGGGGPYPPIAEIVGSALDTVDSLRN
NSIRHLLAHAKGHFNSAKTMLDGRVPAGAYWEYLVAYQIVVDVIPSHRDYYDKINNSRGS
AHRDFNELMRDIKSSEERFMRVKEIIKNDNKRNGASHHSRSISVPSSQHNTPTSSRPTSP
HSSNMPRRDDELMLPEVPTTMPNGRASPADSLDSSRRKPPVQPKPQSLHGRAVRQSLSSI
PGVNDLAQRFANLRSTPPVTTTSAPPSQDLSVKMPSPADYHTTNRLVGPRGIPSQPSSML
PPSLPMLPLDTAFAASLPKEPSPTYSPARNIPGPSSINPPRSTPRSMNGTGGRNNSIAAS
SLSNQAPNVNGAPDSYFPAQQQVRDATGRTRAVNKPVELQIDASMLYDYYRMYNVLTIDV
RDRAQFDAGHVYVRNIMCIEPLTMREGDSAEQLLDRLVISPDEEQAMFDRRNEFDVVVYY
DDSTKNIDFMHRHDRNESERALKQLFDTLYEFNADKPLRRPPVLLKGGLDAWIDLVGPQA
LKMSTTAAFVAAGATRNQTTRRSSVATIQLAKNNQRRSRREYVPMDHEEEELWLEEARKG
RAAVEVPPSSEDQEEEQNTPFYRSTEDFLRRYPDVEAEQSMRDNWKGTKGILPEAYATLL
SNLYKGDVTSVRPSTFRRICGHFNSQWGIDEQQDAKEFLEFVLDYMHEDMNLTWNKPPLK
PLTDQEELTRERFPRQYSAMIEWRRYQHRDMSVIGGMFAGQHASQLTCQTCGVTSTTYEA
FWSISVEIPREGQCDLRECLQSYCAPERLAGDELWRCPRCKKDREAMKKITITRAPDTLV
IHFKRFSASRTESARKVRTPVNFPLQRLDMSPFIEPPMTPEQEAYVAQTARDGPAQLAGV
KSDPTMNGPFVYNAYAVIWHIGATLGSGHYVAFVKDKSRGCWRSFNDDKIQDFDPGNLPA
HNRLQNEKAYIVFYERERVAGGAF
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcggctcctcagccgccctcaggacatctgcccggcaacacgatgaacggc
ttccccaatggcgcacagagtgctggatcagacggcagctccaggggcggtggaggcccg
tatccgcccatcgccgagattgtaggctctgccctggatacggtagactcgctcaggaac
aattcgatccgtcaccttctcgcacacgcaaaaggtcacttcaattcggccaagacgatg
ctcgacggccgtgtgccagccggcgcatactgggaatacctggttgcctaccaaattgtc
gtcgacgtgataccctcccatcgtgactactatgacaagatcaacaacagtcggggttcg
gcacatcgcgacttcaacgagctcatgcgcgacatcaaatcgagcgaagagaggttcatg
cgcgtcaaggaaataatcaaaaacgacaacaaaagaaatggggcgtcgcatcacagtagg
agcatatcggtaccttcatcacaacacaacacacctacgtcctcgagaccaacgtcgcct
cacagttccaacatgcccaggagggacgacgaattgatgctgcctgaagtcccaactacc
atgcccaacggtcgcgcttcacctgctgattctctagattcttcacggagaaaacccccc
gtacaaccgaaaccgcaatcgttgcatggtcgcgctgtccgccagagcttgtcgtcaata
cccggcgtaaacgatctcgctcagcgcttcgccaatctgagatccacccctccagtcact
acgacctcggcaccacccagtcaagatctctcggtcaagatgccctcgccagcagactac
cacaccacaaaccgactcgtgggaccgcgtggcatcccgtcgcagccttcgtccatgctt
ccgccttctctgccgatgctgccgctggacacggcctttgccgcttctttgcccaaggaa
ccgagtccaacctatagtccggcacgaaacataccaggcccttccagcattaatccgcct
cggagtacgcccaggagtatgaatggcacgggaggtcgtaataattccatagccgcatct
agtctgtccaatcaagcgccaaacgtgaatggcgcaccagactcgtatttcccggcccag
caacaggtacgcgacgcgacaggaaggacaagagctgttaataagccggttgaattgcaa
atcgacgccagcatgctctacgactactaccgcatgtacaatgtactcaccattgacgtg
cgcgacagagcccagtttgacgcaggacacgtatatgtgcgcaacatcatgtgcatagag
ccgttgacgatgcgcgagggtgattctgctgaacagcttctggatcgcttagtgatatct
ccagatgaagagcaggccatgtttgacagacggaacgaatttgacgtcgtggtatattac
gatgactccaccaaaaacatcgacttcatgcacaggcatgaccggaacgagagcgagcgt
gcgttgaagcaacttttcgacacactatacgagtttaatgccgacaaaccgttgcgacga
cctcctgttctgctcaaaggtggtcttgatgcctggattgatttggtaggcccacaggca
ttgaaaatgtctaccactgctgcgtttgtcgcggctggcgctactagaaatcagacaacc
cgacgttcatctgtggccacgatacaacttgccaagaacaatcaaagaaggtcaagacgc
gagtacgttcccatggaccacgaggaagaggaactttggttggaagaagcccgaaaaggc
cgtgctgcagtcgaagtcccaccaagtagtgaagaccaagaagaagagcagaataccccc
ttttatcgatccaccgaagactttctgcgtcgctaccccgatgtcgaggccgagcaatcg
atgcgggacaactggaaaggaacaaagggcatcttaccggaggcttacgcgacgctcctc
tccaacctgtacaaaggcgatgtcacatctgtccgtcccagcactttcaggcgtatttgc
ggccacttcaactcacaatggggcattgacgaacagcaagatgccaaggagttccttgag
tttgttctggattatatgcatgaggacatgaatttgacatggaacaaacccccgctcaag
cctcttacagaccaggaagagttgacacgcgagaggtttccacgccagtactcggctatg
atcgagtggcggcgttaccaacatcgtgatatgtccgtcattggtggcatgtttgctggt
caacacgcttcccaactcacatgccaaacatgtggagtcaccagcacgacatacgaggca
ttttggagcataagtgttgaaattcctcgcgaaggccagtgcgatctgcgcgaatgtcta
cagtcgtactgtgcacctgaacgcctagcaggagatgagctgtggcgttgcccacgttgc
aagaaagatcgcgaggccatgaagaagattaccatcactcgcgcacccgacacgctcgtt
atacactttaagcgattcagtgcctcccgaactgaaagcgctcgaaaggttcggacgcct
gtaaacttcccgttacagcggctggatatgtcgcctttcatcgaaccacccatgacgccg
gagcaagaagcgtacgtagcgcagacagctcgtgatgggccggcgcaactggctggagtc
aagtcggaccctacgatgaatgggccctttgtttacaacgcatacgctgtaatatggcat
atcggtgccacactcggcagcggtcactatgttgcttttgtgaaggacaaatcgcgaggg
tgctggagatctttcaatgatgacaagatccaagactttgatcctggaaaccttccagcg
cacaatcgattgcaaaacgaaaaggcgtatattgtgttttatgagagggaaagggtcgct
ggcggggctttctag

DBGET integrated database retrieval system