KEGG   Pyrenophora teres: PTT_11361
Entry
PTT_11361         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pte  Pyrenophora teres
Pathway
pte00100  Steroid biosynthesis
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
Module
pte_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PTT_11361
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PTT_11361
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: EFQ91720
UniProt: E3RRD8
Position
Unknown
AA seq 493 aa
MSKVKSEKKSLDEKPHGYEFLGPPGAFIISFGLPVLVYVFTFLCNDISGCPAPVLLHPYS
FTFEQLKKEVGWTGFSGLLNTQAFLGTLGYYMLSLTLYRFLPGQEVAGTELRSGGKLMYR
FNAWNSALFIMAMLGAGTAVYGAEFPVWTFILENYVGILTSNILISYFLATYCYVSSFSV
KHPKDPSMRELAAGGRTGNMLYDWFIGRELNPRINLPIFGEVDIKAWCELRPGMLGWIIL
DLAFIVQQYRNFGRVTDSIILITVAQAVYIFDALYMEPAILTTIDIIADGFGMMLSFGDL
VWVPFTYTIQTRYLSVYPVDLGLYGVAGVLAVQGIGYYIFRAVNNEKNRFRTNPDDPRVK
HLKYIETAAGSKLLISGWWGTARHINYLGDWFMSWSYVLPTAMSGYLIKNSAQHPITATQ
TDAYFFKDAYGKYVVPDEAKGWGMIFTYFFMVYFAILLVHRERRDEEKCRRKYGKDWDRY
VELVPWRIVPGIY
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtccaaagtcaagagcgagaagaagtcgctcgatgagaagcctcatggttatgagttt
ctaggaccccctggagctttcatcatctcctttggtctcccggttctggtctatgtcttc
acgtttctgtgcaacgacatctctggatgcccagcacctgttcttcttcacccttacagc
ttcacctttgaacagctgaagaaggaggtgggatggactggcttctctggtctgcttaac
acgcaggcctttctcggtaccctgggctactacatgctgagcttgaccttgtaccgattt
ctccctggacaggaggttgcaggtactgagctcaggtctggtggaaagctcatgtacagg
ttcaacgcctggaactcggcccttttcatcatggccatgcttggagctggtacagcagtc
tatggtgccgaattccctgtttggacttttatcctcgagaactacgtcggcatcctgacc
agcaacatcctcatttcctatttcctggccacctactgttacgtttcttctttcagtgtc
aagcaccccaaggatccatccatgcgcgaactcgcagctggcggtcgtaccggcaacatg
ctctacgactggttcattggccgtgaattgaacccgcgtatcaacttgccaatcttcggc
gaggtagacatcaaagcatggtgtgaactacgccctggaatgctgggatggatcattctg
gatctcgccttcattgtgcagcaataccgcaactttggtcgcgtcacagactccatcatc
ctcatcaccgtcgcacaagctgtctacattttcgacgccttgtacatggagcctgccatt
ctcaccaccattgacatcatcgccgatggtttcggtatgatgctttcgtttggcgacctg
gtctgggtcccgttcacctacactatccaaacacgctacctctctgtttaccccgttgat
cttggcctctacggtgttgccggcgtgctcgcagtccagggtattggctactacatcttc
cgcgccgtcaacaacgagaagaaccgcttcaggacaaaccccgacgacccgcgtgtcaag
cacctcaagtacattgagacggccgctggctccaagcttctcatcagcggatggtggggc
actgcacgtcacatcaactacctcggtgactggtttatgagctggtcctacgttcttccc
acagccatgtccggatacctgatcaagaactctgcacagcaccccatcaccgccacgcaa
accgacgcctattttttcaaggacgcctacggtaaatacgtagtacccgacgaggccaag
ggctggggcatgatcttcacctacttcttcatggtctactttgccattctgctcgtgcac
cgcgagaggcgtgacgaggagaagtgcaggaggaagtacggaaaagactgggaccggtac
gttgagcttgttccctggagaatcgtccctggtatctactag

DBGET integrated database retrieval system