KEGG   Pyrenophora teres: PTT_12617Help
Entry
PTT_12617         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pte  Pyrenophora teres
Pathway
pte00052  Galactose metabolism
pte00500  Starch and sucrose metabolism
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PTT_12617
   00500 Starch and sucrose metabolism
    PTT_12617
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PTT_12617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: EFQ90740
UniProt: E3RU71
Position
Unknown
AA seq 581 aa AA seqDB search
MPAPFTLFTAASSLLAVVYAQSSSSISSSSAPLATSTYSQSNVPTGVAIAGKYNQPLRPQ
VHFSPPAGFANDGNGMFLDSNGTYHFYYQYNPTANVAGNQHWGHASSKDMYTWTNEPIAI
FPGGPTEGIFSGSAVVDVNNTSGFFPNQNNGVVAIYTVNTPEQQTQDIAYSHDNGISFIK
YAKNPVIRPGGTHSNQFRDPKVIWYAPTESWVMVVAYPIDFKIGIFTSPNLKDWTPTSNF
SNHGLTGLQYECPNMVEIPVEGAKDGDEPKYLMLISINPGAPLGGSISEYFVGTFNGTHF
EAEDAKTRLTDFAKDNYAGQFFYGIPGNKDQISINWASNWQYTNEVPTAGKEVGDGFRSA
MTVPRGHYLKELPRQGLTLISYPVNIKSITEKELAYEKSLGNGTVFVDYSSVKSGAIYFE
ANVTGLTTGDSLDGTINFSFSSSKSGESVTGGTSISSGDIWLDRGRTEGYQSPFFNDKFS
ATGLYNEADGSWKISAIMDRSIIELFLNGGELGATSVFFPTQPLDMLMVRVSGLNQTATA
SVGVWALKAAWLDQADVNGTVSGNTTHHGVQSRMLGAAKLL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctttcaccctcttcacggccgccagcagcctcctggctgttgtatacgcc
cagagctcttccagtatatcgtcatcgtcggctccattggctacatcgacatactcgcag
agcaacgtgccgacaggcgtggccattgctggcaaatacaatcagccactccggcctcaa
gtacatttctcgcctcccgccggatttgcgaacgatggcaacggcatgttcctcgactca
aacggaacctaccacttctattaccaatacaaccccaccgccaatgttgcagggaaccaa
cattgggggcacgcgagctccaaggacatgtacacctggacgaatgaacctattgcaatc
tttccaggaggcccgacggaaggaatcttcagcggttctgctgtggttgatgttaacaat
acatcgggcttcttcccaaatcaaaacaatggagtagtagcaatctacactgtcaacaca
cctgaacaacagacccaggatattgcgtactctcatgataacggaatctcgttcatcaag
tacgccaagaaccccgtcatcagaccgggcggaacccactccaaccagtttcgcgacccc
aaggttatctggtatgcgcccactgagtcttgggtcatggtcgttgcatatcccatcgac
ttcaaaattggcattttcaccagtcccaacctcaaggactggacaccaaccagcaacttc
tccaaccatggacttactggtctgcagtacgagtgcccaaatatggtcgagatcccagta
gagggggccaaggacggcgatgagccaaaatacctcatgctcatctccatcaaccccggt
gcgcctcttggaggctcgatctcggagtactttgtcggcacgttcaacggcacacatttc
gaggctgaggacgccaagaccagacttaccgactttgccaaggacaactacgcaggccag
ttcttctacggcatcccgggtaacaaggatcaaatcagcatcaactgggcgagcaactgg
cagtacacgaacgaggtacctacagctggcaaagaagtaggagatggtttccgaagcgcc
atgaccgtacctcgcggacactacttaaaggagctgccgcgacagggcctgactttgata
tcctacccagtgaatatcaagtctatcacagagaaggagcttgcatacgaaaagtcactc
ggaaacggcactgtctttgtcgactactcctctgtcaaatctggagcaatctactttgag
gccaatgtcactggacttacgactggcgactcacttgatggcactatcaacttttctttc
tcatcttccaagtcaggagagtcagtcacaggtggtacatcaatctcctcgggtgatatt
tggctagaccgaggtcgtactgaagggtaccaaagcccattcttcaacgacaagttctcc
gccacaggactctacaacgaagccgacggatcgtggaagatctcagcgatcatggaccgc
agtatcattgagcttttcttgaatggtggcgagctcggcgcaacaagcgtcttctttcca
acacagccgctagacatgctcatggtacgagttagtgggctgaaccagacagctacggcg
agcgtaggtgtctgggcgctgaaggccgcatggctcgaccaggcagatgtgaatggcact
gtatctggaaacacgactcatcatggtgttcaaagtcgtatgctgggtgctgcgaagttg
ctctag

DBGET integrated database retrieval system