KEGG   Pyrenophora teres: PTT_14089Help
Entry
PTT_14089         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pte  Pyrenophora teres
Pathway
pte01100  Metabolic pathways
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PTT_14089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: EFQ89580
UniProt: E3RXH3
Position
Unknown
AA seq 241 aa AA seqDB search
MTKPAKHVVFDVVGTCVSFDAYYDVIASVLGDKLVKYTITPKHFGFSWQSAAELEFTFLS
IAGSYKPYKDILRGTFYRTLMLAGVGDPRASFTDEERDQCIEGYSALQLRPGCEAAFNIL
RDNGFTVWCFTTGDVKRVRGYFERAGVHMPMENFISCDGLGVAKPAMAAYQIVYDKLGAN
DIKWFAAAHMWDATAATKVGFRGAWSSVYELEPCLDIFDHAKLEIVAGSLEDMAQQIVDK
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcccgcaaaacatgtcgtcttcgacgttgttggaacctgtgtctcgtttgac
gcatactacgacgtcatagcgtccgtcctgggcgacaaactcgtcaaatacaccatcaca
ccgaagcactttggattcagctggcaatctgctgccgagctggaattcaccttcttgtcc
atagctggcagctacaagccctacaaagacattctccggggaacgttttaccggactctc
atgctcgccggtgtcggcgatcctcgggcttcgtttaccgatgaggagcgcgaccaatgc
attgaaggctactcggctttgcaactccggcctggctgcgaagcggctttcaacatcttg
cgcgacaacggcttcacggtgtggtgcttcactaccggagatgtgaagcgcgtcaggggc
tacttcgagcgtgccggcgttcatatgcccatggaaaacttcatcagttgcgacggcctt
ggagtagccaagcccgcaatggccgcttatcagatcgtctatgacaagttgggagcgaat
gacatcaaatggtttgctgctgcgcacatgtgggatgctacggcggcgacaaaagtgggg
ttccgaggtgcatggagttcggtctatgagttggaaccttgcttggacatcttcgaccat
gcgaaactggagattgtggctggaagtttggaagacatggcgcagcagattgtagataaa
tcatga

DBGET integrated database retrieval system