KEGG   Pyrenophora teres: PTT_14229Help
Entry
PTT_14229         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
Organism
pte  Pyrenophora teres
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 BetaGal_dom2 BetaGal_dom3
Motif
Other DBs
NCBI-ProteinID: EFQ89485
UniProt: E3RXS0
Position
Unknown
AA seq 1009 aa AA seqDB search
MKTLAGLSWISALSSLATLPNGFGVSAQNNTPNAWPLHDNGLNNVVQWDHYSFKVNGKRL
FVFSGEIHYWRIPVYEVWEDLLEKIKAAGFTAFAFYGNWAYHSANNQTLDFESGAHDFSK
LFEIAHRVGLYVITRPGPYVNAEANAGGFPLWLTTGAYGKLRDDDPRYLQALDPYFSKFS
ELTSKHLVTNGGNALVYQIENEYGEQWKDRTKKIPNDVAARYMQALEDSARSNGIEIPLI
HNDPNMNTKSWSKDYAPGAVGNVDIAGLDSYPSCWSCNLAECTGTNGKYVAYQVVNYYDH
FKEVSPTQPSFFPEFQGGSYNPWGGPEGGCPGDIGADFANLFYRNLISQRVTAVSLYMMF
GGTNWGAIAAPVTATSYDYSSPISENREIGAKFYETKNLAMFTRVADDLTITDRLGSSSS
YTTNSAVTASELRNPITKAAFYVTIHSVSSSSTTESFKLHVSTSVGNLTIPQHSGSIVLN
GHQSKIISTDFAMGNKTLTYSTAEILTYALIDFNPVVVLSTGVGESVEFHVKGATKGSLA
SSGSTSNATFRVEAGGVTTNTERVYGMSVYQFDNGVKVVVADKPTAYLFWAPNLSNDPFA
PVDQSVLVQGPYLVRATALDGDVLALKGDVKNSTTIEVFVHETAHTLSWNGKKLETLRTP
YGSLKAHVSAFDGTISLPSLNDWKVNEGLPEKMPEYDDSGAAWVVANHTTTPNPTKPDTL
PVLYVDEYGFHNSFHLFRGYFEGSAKGAQLSVQGGLAFGWSAWLNGDLVGSWLGNTTLGV
GNMTLSFANATVHANDTNVLLIAQDNTGHDLRGGATNPRGILRATLDGADFTSWKIAGEA
GGEDIQLDPVRGPLAEGGLTAERLGWHLPGFSDGNWASASPSTGFSGADIKFYRTTFPLD
VPKDVDASFAFILNATGPKTVRVQLFVNGYQYARFNPYVGNEIKFPIPPGILNYAGDNVI
GLSVWAQKDDGAKIDVQFVQEYAVESSWSSRFDSEYLRPKWTEERLAYA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctcgcggggctgtcctggatatcggccttgtcatcattggctactctgccc
aacggattcggcgtcagcgcccagaacaacacacccaatgcgtggccactccatgacaat
ggtctgaacaatgttgtgcaatgggaccactattccttcaaggtgaatgggaaacgtctc
ttcgtcttctccggagaaattcattactggcgtattccagtctatgaggtctgggaagac
ttgctagagaagatcaaggctgcaggcttcacggcctttgccttctatggcaactgggcc
tatcacagcgcgaacaaccaaaccctggactttgagagcggcgcacatgacttcagcaag
ctctttgagattgcgcatcgtgttggcctttacgtcatcactaggcccggcccctatgtt
aacgctgaagcaaatgctggcggcttcccactatggctcacaacaggggcttatggaaag
ctcagagatgacgacccgagatatcttcaggctctggatccctacttttccaagttttct
gagctcacgtccaagcatcttgtaacaaatggcgggaacgcactcgtttaccagattgag
aatgagtacggtgagcaatggaaggacagaacgaagaaaatccccaacgatgttgctgcg
aggtacatgcaggcactggaggattctgcgcgatccaatggcatcgagattcccctgatt
cacaacgatccgaatatgaacaccaagagctggagtaaagactatgcgcctggtgctgtg
ggaaacgtcgacattgccggattggatagttatccatcttgttggtcatgcaaccttgca
gaatgtacgggtacaaacggaaaatacgtggcataccaagttgtgaactattatgaccat
ttcaaggaggtgtcacccactcagccaagtttctttcccgagttccaaggcggctcatac
aatccgtggggaggcccggagggtggctgcccaggtgatatcggcgcagactttgcaaat
ctcttctaccggaacctcatctctcaacgagtcactgctgtatcgctctacatgatgttt
ggtggtaccaactggggcgctattgccgccccagtcacagctacatcgtacgattacagc
agtccgatcagcgagaatcgcgaaattggcgccaaattctatgagaccaagaacttggcc
atgttcacccgtgttgcagacgacttgaccattaccgaccgtctcggaagctcgagctca
tacactaccaactccgctgttacagcgagcgagctccgtaaccctatcaccaaagctgcc
ttctacgttacaatccattccgtatcatcttcttccacaacagagtcgttcaagctacac
gttagcacatctgtcggaaacctgaccatcccccagcattccggttcaattgttctcaat
ggccatcagtccaagattatctcgactgactttgctatgggcaacaagactctcacctac
tccacggcggagatactcacatatgccctaattgatttcaacccagtagtggtactatca
acaggcgtgggagaatcagttgagttccacgtcaagggcgctacaaagggttctttggcc
agcagtggatctacttcgaatgccactttccgtgtcgaagcaggtggagtcacaaccaac
accgagagggtatacggcatgagcgtatatcaatttgacaacggcgtcaaggttgttgtc
gccgacaagcccactgcatacttgttctgggctcctaacttatcaaacgatcccttcgcg
cctgttgaccaatctgtcttggttcaagggccttatctcgttcgcgctaccgcgctggat
ggagatgtgctcgcattgaagggtgacgtcaagaatagcacaaccatagaagtctttgta
catgaaactgcccatacgctctcctggaacggaaagaagctagagactttgcgaacacca
tacggcagcttgaaggcccacgtctctgcattcgacggtaccatctccctaccctcccta
aacgactggaaagtcaacgagggacttccggagaaaatgccagagtacgacgacagcggt
gcagcttgggtcgtcgcaaatcataccacaacacccaaccctaccaagcccgatacacta
cccgttctatatgttgacgaatatggcttccacaacagcttccacctcttccgaggttac
tttgaaggatcagctaagggtgcccagctctctgtgcaagggggtctcgcctttggttgg
agcgcatggctgaacggtgatctagttggatcgtggttgggcaacacaactctaggtgtc
ggtaacatgacgttatcgtttgccaacgccactgtacacgcgaatgacacaaacgttttg
cttatcgcccaagataacactggccatgatctgcggggtggtgctaccaacccccgcggt
attctccgcgctactctcgacggtgcagacttcacgtcttggaaaattgcaggcgaagct
ggtggcgaggacatccaactcgaccctgtacgcggacctcttgccgaaggcggtctcaca
gccgaacgtcttgggtggcacctacccggcttctctgacggcaactgggcctctgcttcg
ccatccaccggcttctctggcgcggacatcaagttctaccgcacaacattccctctcgac
gtccccaaagacgttgatgcttcttttgcttttattctgaacgccaccggtcccaaaact
gttcgtgttcagctcttcgtcaacggctaccagtatgcacgattcaacccatacgtgggc
aacgaaatcaagttcccaatcccgccgggtatcctcaactatgcgggtgacaatgtaatt
ggactgagtgtgtgggcacagaaagatgacggtgcgaagattgacgtgcaatttgtgcaa
gaatatgcggtggagagtagttggagctcaaggttcgactctgaatatctacggcctaag
tggacagaggagaggttggcttatgcctaa

DBGET integrated database retrieval system