KEGG   Pyrenophora teres: PTT_15236Help
Entry
PTT_15236         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte00010  Glycolysis / Gluconeogenesis
pte00620  Pyruvate metabolism
pte00640  Propanoate metabolism
pte00680  Methane metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_15236
   00620 Pyruvate metabolism
    PTT_15236
   00640 Propanoate metabolism
    PTT_15236
  Energy metabolism
   00680 Methane metabolism
    PTT_15236
Enzymes [BR:pte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PTT_15236
Lipid biosynthesis proteins [BR:pte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PTT_15236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: EFQ88758
UniProt: E3RZT3
Position
Unknown
AA seq 668 aa AA seqDB search
MSEGDVKPPVVAEAHEVDTFHVPKAFYEKHPHSRPHLENLEEYQKLYKESITDPKAFWGR
LARELLTWERDFQTVHSGSFEHGDNAWFLEGRLNASYNCVDRHAFKDPNKPAIIYEADDE
GDGRIITYGELLRQVSKLAYTLKEMGVRKGDTVALYLPMIPEAVISFLACTRIGAVHSVV
FAGFSSDSLRDRINDAECKVVITTDEGKRGGKTISTKKIVDDALKQCPGISHCLVYKRTG
AEVPWTKGRDWWWHEEVEKYPNYIAPEPMNSEDPLFLLYTSGSTGKPKGVMHTTGGYLLG
AAATGKYVFDIHDNDVFFCGGDVGWITGHTYVVYAPLLLGVATVVFEGTPAYPNFSRYWD
IVDKYNVSQFYVAPTALRLLKRAGDEHVKHKMKNLRILGSVGEPIAAEVWKWYFETVGKE
EAHVVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEGV
LAFKQPWPSMARTVWGAHKRYMETYLTVYKGYYFTGDGAARDHEGYYWIRGRVDDVVNVS
GHRLSTAEIEAALIEHHQVAEAAVVGIHDELTGQAVNAFVALKDGTESSDQVKKDLVMQV
RKSIGPFAAPKAIFVVPDLPKTRSGKIMRRIMRKILAGEEDQLGDITTLSDPSVVDKIID
IVHQSKKK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggagacgtcaagccgcccgtcgtggccgaagcacacgaggtcgacacattc
cacgttcccaaggcgttttacgaaaagcacccgcattcacggcctcatctcgagaacctc
gaagagtaccagaagctgtacaaagaatccatcaccgacccaaaagccttctggggcaga
ttagcgcgcgaactgctcacgtgggaacgcgacttccagacagtacactcgggcagcttc
gaacatggcgacaatgcgtggttcttggaaggcagactgaatgccagctacaactgtgtt
gatcgccatgccttcaaggaccccaacaagcccgccatcatctacgaggccgacgacgag
ggtgatggccgcatcatcacatacggcgagctactccgccaggtttcaaagctagcctac
acactcaaggaaatgggcgtaagaaagggtgacacagtcgctctttacttgcccatgatt
cccgaagccgtcatctcctttttggcatgcacgcgcatcggtgctgtccactcagtcgtc
tttgctggcttttcgtctgattcactacgcgaccgcatcaacgacgccgagtgcaaggtc
gtcatcaccaccgacgagggcaagcgcggcggcaagaccatcagcaccaagaagatcgtc
gacgacgctctgaaacaatgtcctggcatcagccactgcctggtgtacaagcgcactggc
gccgaggtcccttggaccaagggacgtgactggtggtggcacgaggaggtggaaaagtac
cccaactacattgcaccagagcccatgaactcggaagaccctctgtttttactctacaca
tcgggttcgactggtaagcccaagggtgtcatgcacacaacaggtggctatctccttgga
gcagcagcaactggaaagtacgtcttcgatatccacgacaacgacgtcttcttttgcggt
ggtgatgtgggttggatcacaggccatacatacgtcgtatacgctcctttgctgctcggt
gtcgctactgttgtgttcgaaggcacccctgcctacccaaacttctcgcgctactgggat
atcgtcgacaagtacaatgtcagccagttctacgtagcgcccactgcactgcggcttctt
aagcgtgcaggcgatgagcacgtcaaacacaagatgaagaacctaagaattctcggatcc
gtcggcgagccgattgctgcagaggtgtggaagtggtattttgagactgtcggaaaggag
gaggcacatgttgttgatacgtactggcaaaccgagacgggctcccacgtgattacaccc
ctgggtggcatcacgcctacgaagcctggatctgcgtctcttccctttttcggtatcgag
ccggcgattatcgatcccgtctcgggcgaggagattcacggtaacgatgttgagggtgta
ctggccttcaagcaaccatggccaagcatggcacgcacagtctggggagcacacaagcga
tacatggagacatatctgacggtatacaaaggctactacttcactggagacggtgccgca
cgtgaccatgagggctattactggattcgaggacgcgttgatgacgttgtcaacgtttcc
gggcacaggctgtcgactgctgagattgaggcggcacttattgaacaccaccaagtggct
gaggcggcagtagtgggaatccatgacgaactgacaggccaagcagtcaacgcctttgtg
gcgctcaaggacggcacagagtcaagtgaccaagtgaagaaggacttggtaatgcaagtg
cgtaagtcgattggtccgtttgccgcaccaaaggcaatttttgtagtgccagatctgccc
aagacgcgatccggcaagattatgcgtcgtatcatgcgcaagattctggctggagaggag
gaccaactgggcgacatcacaacgctttcggatccgtcggtagtcgacaagatcatcgac
attgtgcaccagtcgaagaaaaaatag

DBGET integrated database retrieval system