KEGG   Pyrenophora teres: PTT_17759Help
Entry
PTT_17759         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pte  Pyrenophora teres
Pathway
pte03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pte00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PTT_17759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pte03041]
    PTT_17759
Enzymes [BR:pte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PTT_17759
Spliceosome [BR:pte03041]
 Complex C
  Other components
   Step II factors
    PTT_17759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD T2SSE AAA_30 AAA_14 AAA_19 DUF2075 SRP54 PhoH AAA_7 RSRP
Motif
Other DBs
NCBI-ProteinID: EFQ86962
UniProt: E3S583
Position
Unknown
AA seq 1214 aa AA seqDB search
MDDLENLEFLSLVSKVTSEIQNHLGVSDKTLAEFVIDQHAKCKGVADFKSQLEAMGAEFP
QSLVESIDRLILTLHPKYKNKGAKAAGANGQDGGDATDRKTRVFKGLAIPDKEVDYEVAD
EAPANEAPDVDALDDTFAMLEGLAGKAPGKPKARSRKRSMSPYDSDDDIARSKRYRRRNT
SGSRSRSRSTSPRRGREQNDELVFEDEFGRTRTVKPSNKQRTRKKYRDEDLDEFRRPPTP
ELDEEPVLYKIYNGKVTGIKDFGCFVNIQGVKGKVDGLVHVTQMMEGRVNHPSDLVSRWQ
EVKVKVIKTENGRISLSMKEVDQQTGRDLAPGKRIASFGTGANSSGLGGIPGVDSTVPVV
EDGYNGRKNGMRKRMTSPERWEIKQLIASGVIPKSDYPNIDEDYNAHINGEGGFEEEEDV
DIEVREEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRAAMAGDTLAKERRDLKQQEAQEK
AAKEAANVDLSSQWNDPMAQQRQFASDLRNTRTNEPAQALPEWKKISTNSRETSFGKRTN
MSIKEQRESLPVYKFRNKLLEAIANNQILIVVGDTGSGKTTQMTQYLAEAGYGNELVIGC
TQPRRVAAMSVAKRVAEEVGCALGNEVGYTIRFEDKTSPETRIKYMTDGILQREILLDPM
LSKYSCIMLDEAHERTIATDVLFGLLKKTLKRRPDMKLIVTSATLDADKFSEYFYKCPIF
SIPGRTFPVEVMYSREPESDYLDAALVTVMQIHLTEPAGDILLFLTGKEEIDSSCEIISE
RMKALGPNVPELMILPIYGALPSEVASRIFEPAPNGTRKVVIATNIAETSLTIDGIYYVV
DPGFVKQSSYDGKLGMDRLQITPISQAQARQRSGRAGRTGPGKCFRLYTEAAFQNEMLPT
TIPEIQRQNLSNTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYQLGALDDEGLLTR
LGRQMADFPMDPSLSKSLIKSVELQCSDEILTIVAMISATQNVFHRPRDKQQQADQKKQK
FNDPSGDHITLLNVYNGWKQGGFSTPWCHENFIMPKNMQRVRDVRNQLLQIMARHKHQVV
SCGRNTIKVRQALCSGFFRNSARKDPAEGYKTLVEGTPVYLHPSSSLFGKPAEHVIYHSL
VETTKEYMHFCSAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNKFAGEDDWRLS
AQRRAGRGGGGTWG
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctggaaaacctcgagttcctctcactcgtttccaaagtgacttccgaaata
cagaatcatcttggcgtatccgacaaaacgctcgccgaattcgtcatcgaccagcatgcg
aaatgcaaaggcgtcgcagacttcaagagccagttagaagctatgggagctgaatttccg
cagagtctggtggaaagtatcgaccgcctgattcttacactacatccaaagtacaagaat
aagggcgcaaaagctgcgggcgcaaacgggcaagatggtggagatgcgacagatcgcaag
acgcgtgtcttcaagggcctcgcgattcccgacaaggaggtcgactacgaggtagctgac
gaagcgcctgcaaacgaagcgccggatgtcgatgcgctggacgatacatttgccatgttg
gagggtctggcaggcaaggcgccgggcaagcccaaggccaggtcgcggaagaggagcatg
agcccatacgatagcgacgatgatatcgctagaagtaagcgatacaggcggaggaacacc
tcaggctcgcgctcgcgctcgcggtcaacaagcccacgccgagggcgggagcagaatgat
gagctggttttcgaggacgaatttggacgcacacgaaccgtcaagccaagcaacaagcaa
cgaacgcgcaagaagtaccgcgacgaagatctcgacgaattccgacggccgcccactccc
gagctcgatgaagagccggtattatacaaaatctacaatggcaaggtcacaggcatcaag
gattttggctgcttcgtcaacattcagggcgtcaagggcaaagttgatgggctagtgcat
gtcacacagatgatggagggtcgcgttaaccacccgtctgatcttgtatcgaggtggcag
gaggtcaaagtcaaggtcatcaagacggaaaatggcaggatatcgctgtcgatgaaggag
gtggatcagcaaacaggtcgcgaccttgcgcccggaaagcggatagcgtctttcggaacc
ggcgcaaactcgtcgggactgggaggcataccaggggttgatagtactgtgcccgttgtc
gaagacggttataacggccgcaagaatggtatgcgaaagcgcatgacttcgccagaacgc
tgggagatcaaacagctcattgcttccggtgtaataccaaagtcggactacccgaacatc
gacgaggactacaacgcgcacattaacggcgagggtggtttcgaggaagaggaggacgtg
gatattgaagtacgcgaggaggaacctccattcctggctggtcaaaccaagcaatcgctc
gagctctccccgatccgagtagtcaaggcacccgacggctcgctcaatcgcgctgccatg
gccggagatacgctcgcgaaagaacgccgtgatctaaaacagcaggaagcccaagagaag
gccgcaaaggaagcagcgaatgttgacctgagcagccagtggaacgatcccatggctcaa
caacgccagtttgcaagcgatcttcgcaacactcgcaccaacgagcctgctcaagcactg
ccggaatggaaaaagatctccacgaacagtcgggaaacttcattcggcaagcgtaccaat
atgagcatcaaggaacaacgagagtccttgcccgtctacaagtttaggaacaagcttctc
gaggctatcgcaaacaaccaaatcctgattgtcgttggtgatactggatctggaaagacc
acgcaaatgacacaatacctagctgaagctggatatggcaacgagcttgtcatcggttgc
actcagccgaggcgtgtagcggcaatgagtgttgccaaacgtgtcgcagaagaggttggc
tgtgcccttgggaatgaggtcggatacacaattcgattcgaagacaagacctcaccggaa
acccggatcaaatacatgacggacggtatcctgcagcgtgagattctcctggaccctatg
ctgtcaaagtatagttgtatcatgcttgacgaagcccacgaacgtaccatcgccacagat
gtcctgtttggactactgaaaaagaccctcaagcgacgcccggatatgaagctcattgtt
accagtgccaccctcgacgctgacaagttctctgaatacttctacaaatgccccatcttc
tctatcccaggtcgaaccttcccagtagaggtcatgtacagtcgagagccagaatccgat
taccttgacgcagcgctcgtgaccgtcatgcagatccatttgacggagccagcaggtgac
atattgcttttcttgacgggcaaagaggagattgattcatcttgcgagattatatccgag
cgtatgaaagcacttggaccaaacgtgccagagctgatgattctacccatttatggagct
cttccatcagaggtcgcatcccgtatcttcgaacccgcgcccaatggaacccgcaaagtc
gtcattgctaccaatatcgctgagaccagtttgactatcgatggtatctactacgttgta
gatccgggttttgtcaagcagagttcgtacgatggaaagctgggcatggatcgtctgcaa
attacgcccatctcgcaagctcaggctcgtcaaaggagcggaagagcaggaagaacaggc
ccaggaaagtgtttccgcctgtataccgaagcagcgtttcagaatgagatgttaccgact
actatcccggagatccagcgtcagaacctgtcaaatacgatcttgatgcttaaagccatg
ggtatcaacgatttgttacattttgacttcatggacccaccgccgacaaatactatgttg
acggcgctggaggagttgtatcaactgggtgcactggatgacgaaggactgcttacgcgt
cttggtcggcagatggctgacttccccatggacccctcactctctaaatctctcatcaag
tcggttgaactacaatgctcagatgagatcctcacaattgttgcgatgatcagcgccaca
cagaacgtcttccaccgaccgcgagacaagcaacaacaagccgaccaaaagaagcagaag
ttcaacgatccctccggtgatcatatcaccctgctaaatgtgtacaatggctggaaacag
ggaggcttcagcacgccctggtgtcacgagaacttcatcatgcccaaaaatatgcagcgt
gttcgcgacgtgcggaatcagttgctacagatcatggcgcgacacaagcaccaagtcgta
tcttgtggccgcaacacgatcaaagtccgacaagcgctgtgctcagggttcttccgcaac
tcggctcgtaaagatcctgctgagggctacaagacactcgtcgaaggcacgcctgtctac
cttcacccatcttcttctctgtttggcaaacctgccgaacacgtcatttaccactcgctc
gttgagacgacaaaggagtacatgcacttttgctctgccatcgaacccaagtggcttgtc
gaagcggcgccgacgttcttcaaggtggcgcctacagatcggttgtccaagagaaagaag
gcggagaggatacagcctctgcataacaagtttgcgggtgaggatgattggagactaagt
gctcagagaagggctggcaggggtggaggaggtacatggggctga

DBGET integrated database retrieval system