KEGG   Pyrenophora teres: PTT_17950Help
Entry
PTT_17950         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pte  Pyrenophora teres
Pathway
pte00970  Aminoacyl-tRNA biosynthesis
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PTT_17950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pte03029]
    PTT_17950
Enzymes [BR:pte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PTT_17950
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PTT_17950
Mitochondrial biogenesis [BR:pte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PTT_17950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: EFQ86739
UniProt: E3S5M8
Position
Unknown
AA seq 609 aa AA seqDB search
MLARITRASFAVASKRPYICQSCIKRPRRSELGAAHLLPLHTIRYLQIETSTSFRKTLKD
AAKEQKKVKKKKRWGSDEPLDPAILNKHARAEKWELTVGVEVHAELNTARKLFSKATTSV
GEAPNTHAALFDVAFPGSQPVFQLDTLVPALRAALAFQCEIPPRSSFDRKHYFYQDQPNG
YQITQYYEPFAKNGKLALYPHDFPADKTPQLTPMYIGIKQIQMEQDTAKTIQHPPSTHLL
DFNRVSHPLIEIITMPEIHDPIVAAAAVRKIQMILKAVNACTTGMELGGLRADVNVSVRC
HGESSQGASHSYHGVTGLGQRTEIKNLSSFKAVEDAIIAERDRQIEILESGGVIEGETRG
WTLGSTTTKRLRSKEGEIDYRYMPDPDIAPIIISDRLIEHLRKTLPMLPDELEHRLTSTY
SLTAKDAMTLLTIDDGERLEYFLATITNLSEDWGDEASNTKSRLGKMAGDWVLMELGSMF
KQLPWDANRVPPEYLADVISHVYRKVITSPTGKRLLTMKFEGDERSVAEIVKEESLALRP
LSEEEYREMAQTLLERNPEMVMDILRKGQTKKVYWFMGQMMAKAPKGSMEPNKAKKVLEA
LLGLDGKIY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgctggctcgcatcacccgcgccagctttgctgtagcttcgaaacggccatatatctgc
caatcatgtatcaagcgaccgagacgttccgaattgggtgctgcacaccttcttccattg
cacacgatacgatacctccagattgagacgtcaacatctttccgcaagacgttgaaagat
gctgcaaaggagcagaagaaggtgaaaaagaagaagaggtggggatctgacgagccgtta
gacccggccattttgaacaagcatgcacgagccgaaaaatgggaattgactgtaggggtt
gaagtgcatgccgaactcaacactgcacggaagctcttctccaaggccaccacatcggtg
ggtgaagcaccaaatactcacgccgctctctttgatgtcgcatttccaggttctcagccc
gtattccagctggacactctcgtacccgccttgcgcgccgccttagccttccagtgcgag
ataccaccccggagcagcttcgatcgcaaacactacttctatcaagatcagcccaatggc
taccagatcacacaatactatgagccttttgcgaagaatggaaagctcgcactctatcct
catgactttcctgctgacaaaaccccacaactgacccctatgtatattggcatcaagcaa
atacagatggagcaggacaccgccaagaccatacagcatccaccttcgacgcacctactc
gattttaaccgcgtctcgcaccctctgattgagatcatcacgatgcccgagattcatgac
cctatcgttgctgctgccgctgtgcgcaagatacaaatgatactcaaggctgtcaatgcc
tgtactactggtatggaattgggaggcttgcgggctgacgtcaatgtatctgttcgttgt
catggggagagctcacagggagccagccattcataccacggtgttactggcctaggccaa
cgaacggagatcaaaaacctgtcaagcttcaaagctgttgaagatgcgattatcgcagag
cgcgaccgccagatcgaaattctcgagagtggaggcgtcatcgaaggcgagacccgtggg
tggactcttggaagcacgacaacgaagcgcttgaggagcaaagagggcgaaattgactac
cgttacatgccagacccagacattgctcccatcatcatatcagacaggcttattgaacac
ctccgaaaaacactgccaatgcttcccgacgagctcgagcaccgcctgacctcaacatat
tcgctcactgccaaagacgccatgacacttctcacgatagacgacggcgaacgtttggag
tatttcctggctactatcaccaacctttccgaagactggggggatgaagcgagtaacaca
aagtcaagactgggtaaaatggcgggggactgggtactaatggagctgggctccatgttc
aaacaactaccatgggacgctaaccgcgttccacccgaatatcttgccgacgtcatttcg
cacgtttaccgcaaggtgataacatcacccaccggcaaacgcttgctcacaatgaagttc
gagggtgatgaacgcagcgtggctgaaattgtgaaagaggaatctctggcactgcgtccc
ctgagcgaggaagaatatagggagatggcgcagacgctactggagaggaaccccgagatg
gtgatggatattctcagaaaaggtcaaactaagaaggtatattggttcatggggcagatg
atggcgaaggcgcccaagggaagtatggagcctaacaaagccaagaaggtgctggaagcg
ttactggggctagacggaaagatttactga

DBGET integrated database retrieval system