KEGG   Pyrenophora teres: PTT_17968Help
Entry
PTT_17968         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PTT_17968
Transfer RNA biogenesis [BR:pte03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PTT_17968
Chromosome and associated proteins [BR:pte03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PTT_17968
   HAT complexes
    Elongator complex
     PTT_17968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: EFQ86708
UniProt: E3S5N9
Position
Unknown
AA seq 422 aa AA seqDB search
MRAIRARYDPYEQARGRVDQIKSLGHSVDKVEYIIMGGTFMSLPESYRDEFISQLHNALS
GYQTTDVDEAVAAGEMSNIKCVGITIETRPDYCLDQHLSSMLRYGCTRLEIGVQSLYEDV
ARDTNRGHTVSAVAKTFCLAKDAGFKVVSHMMPDLPNVGMERDLDQFVEYFSNPSFRTDG
LKIYPTLVIRGTGLYELWRTGRYKNYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLV
TSGVENGNLRELALARMKDFGTTCRDVRTREVGINEVKHKIRPDQVELVRRDYTANGGWE
TFLAYEDPKQDILIALLRLRQCSKEHTFREELVGQPSSLVRELHVYGSAVPIHARDPKRF
QHQGYGTLLMEEAERIAREEHGSSKISVISGVGVRSYYAKLGYWLDGPYMSKTLEPLWER
EW
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatccgcgcacgctacgacccgtacgagcaagcccgtggccgtgtagaccaa
ataaagtctctcggccacagcgtggacaaggtagagtacatcatcatgggcggcaccttc
atgtcgctcccagagtcgtaccgagacgaattcatatcgcaactgcacaacgccctctct
ggctaccaaaccaccgacgtcgacgaagcagtcgccgccggcgaaatgagcaacatcaaa
tgcgttggcatcacaatcgaaacgcgcccagactactgcctagaccaacatctctcctcg
atgctgcgctacggctgcacccgcctggaaatcggcgtccagtccctctacgaagacgta
gcccgcgacaccaaccgcggccacaccgtgtccgccgtggcaaaaaccttttgcctcgca
aaggacgcaggcttcaaagtagtatcacacatgatgccggacctgcccaacgtaggaatg
gagcgcgacctcgaccaattcgtcgaatacttctcaaacccctcgttccgcaccgacggc
ctgaaaatctaccccacgctcgtgatccgcggaacagggctgtacgaactctggcgtacg
ggccggtacaagaattataccccaaatgccctcatcgacatcgtcgctaggatcctcgcc
ctcgtcccgccctggacgcgcatctaccgcgtccagcgcgacatccccatgccgctggtt
acgtccggcgtggaaaacggtaatctgcgtgaactagctctcgctcgcatgaaggacttt
ggcacgacttgccgcgacgtgcgcacgcgcgaggtcggcatcaacgaggttaaacacaag
atccgccccgaccaggtcgaactcgtacgcagggactacacggcaaacggcgggtgggag
acttttctcgcctacgaggatccaaagcaggatattttgattgccttgttgaggctacgg
cagtgttccaaggagcatacgtttagggaggagttggtggggcagccgtcgtcgttggtg
agggaactgcatgtttatgggtctgcggttccgattcatgcgagggatccaaagaggttt
cagcatcaggggtatgggactttgttgatggaggaggcggagaggattgcgagggaggag
catgggagcagcaagattagtgtgatttcaggcgtgggagtgaggagttattatgccaag
ttggggtattggctcgatgggccgtatatgagtaagacgcttgagccgctgtgggagagg
gagtggtag

DBGET integrated database retrieval system