KEGG   Pyrenophora teres: PTT_18202Help
Entry
PTT_18202         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pte  Pyrenophora teres
Pathway
pte00860  Porphyrin and chlorophyll metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTT_18202
Enzymes [BR:pte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PTT_18202
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTT_18202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: EFQ86521
UniProt: E3S676
Position
Unknown
AA seq 376 aa AA seqDB search
MSFSSLVSDIAYRNSERPERPDLRSQVSEARSTRSYASTAATSVSISGDIKSQLHGGYSH
PLSRAWQAERQLTKSMLIFPLFISDQPDEETLIPSLPNIHRRGLNKIVPYLTPLVAKGLK
SVILFGVPLAPTAKDALGTNADDPKGPVIKGIRLLRRAFPDLFIVADVCLCEYTSHGHCG
ILRDDGSLNNALSVERIADVAISYAQAGAHCVAPSDMNDGRIRAIKLRLIEAGIAHQVVL
MSYAAKFSGCLYGPFRDAAGSVPSFGDRRCYQLPPGGRGLARRAIVRDIDEGADIIMVKP
ANQYLDIISDAKEIGKDMPIAAYQVSGEYAMIHAAAAAGVFGLRQMAEESTQGILRAGAS
IVVSYFTPEFLDWLGH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcttcgctagtctcggatatcgcgtaccggaactctgaacgacctgagcgt
cctgacctgcgttcccaagtttccgaagcgcgctccacgcggtcctatgctagcactgct
gccaccagcgtgagcatttctggcgacatcaagagtcagttacatgggggttacagccac
ccgctttcgcgagcatggcaggccgaaaggcaacttaccaagtccatgctcatcttcccc
ctcttcatatccgaccagcctgatgaagaaacgcttattccctcccttcccaacattcac
cgccggggcctaaacaagatcgtgccctaccttacgccgcttgtcgcaaagggcctgaag
tcggtcatattattcggcgtaccacttgcacccactgcaaaggatgcgctcggcaccaac
gccgacgacccaaaagggcccgtaatcaagggtatccgactgctccgacgagccttccct
gacctcttcatcgttgccgatgtctgtctctgcgaatacacctcacacggccactgtggt
attctacgcgatgatggcagtctgaacaacgccttgtcggtagagcgcatcgcggatgtg
gctatatcatatgcacaggccggtgcgcattgcgttgcgccctcggacatgaacgatggt
cgcatacgcgccatcaagctgaggctgattgaggccggaatcgcacaccaagtagtatta
atgtcctacgccgcaaagttctcaggctgcttatacggcccattccgtgacgctgcaggc
tcagtaccttcgtttggcgatcgaagatgctatcagctaccacctggcggccgcggactg
gcgcgacgagctattgtaagagatattgatgagggcgccgacataatcatggtcaagcca
gccaatcaatacctcgacatcatcagcgatgcaaaggagattggaaaggacatgccaatc
gcggcataccaagtatctggcgaatatgccatgattcatgccgcagcagcagcaggcgta
tttggcttgaggcagatggcagaagagtctactcagggcattctacgcgcaggcgcttct
atagtagtcagttacttcacacctgagttcctggactggctaggtcactga

DBGET integrated database retrieval system