KEGG   Parasteatoda tepidariorum (common house spider): 107436121Help
Entry
107436121         CDS       T06106                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107436121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptep03041]
    107436121
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107436121
Spliceosome [BR:ptep03041]
 Complex C
  Other components
   Step II factors
    107436121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 OB_NTP_bind DEAD IBR zf-C3HC4_2 zf-RING_UBOX zf-C3HC4 zf-RING_2 Helicase_RecD RRM_1 AAA_22 zf-C2HC
Motif
Other DBs
NCBI-GeneID: 107436121
NCBI-ProteinID: XP_015903183
Position
Unknown
AA seq 2149 aa AA seqDB search
MEQNLKEIKALPDDFSFPVSLSDVKTEDVASSDLSYLAVSTSLPKLNKTYEACKKENESE
KICQDLKYHDRESYVSQRDRKIGIGLFNINEIEDLPPRHKKKVVSAYEKLRSYEIYLLSK
KSESNASSISPPPGFFDPKTDRDSTCLVSKSTKNLNNSISNVPKVKETQEHSFNNMLTES
QSDKFSNDHIYNTSKPKYTNNSCENMHQENHSQIKMKTRRFESHKKSTNNCDAFNTLVPS
DSAMQSTHHKHKCSLKNCETDPDIDHIRDGSEKSAVSIDRRERNNHYFHANHVYNPSTQY
GGQNEDLDVKNCEDYENSKKNSKLKVSRDTNFQSKNDRSNLNRNHYRTQKSKSKYSIGET
NQNSKQYTTKESKHEESYHSFGCEDTNLSFATESNSDNAKKESSHYDSGTFSNRSNLANK
STKQTSETIDLKKIYSDKECYRSNHSRNEKFEGKCLNFYQNPDTNRGIPCRKRHSSDLSN
TSYSALSDKNFKGKCNYEQQSTYSDQKDENFYSQSASQKTRPSKQGILSSDLSQIFRDID
RVKAREETKIDAKRMLRVKDEGFFLHISIFEPSNSLEMWETFFKKHLKMENFEVSKCCDF
TESVILSFNNIKNAHQAHFLLYKLKHKTKDTSKRLIKSLSSIKRHLIKPCMCENDVIEHC
DKYFDEFAAKYISIQKAKINAVIGELNSLQISKSNIVKEEKYLSLKDTLDNLKAMEIVFL
NCLRKTKNAAEKLKKVEVDGSMSDFMELKLNFCKECNSFERGLPIYSQKDVILNAIRNFP
VTVIVAETGSGKSTQLTQYLWQTYFVNYGSIICTQPRKIAAISITKFVSTQIGSSVGKEV
GYDVGIEKKFDNSTKIIYMTDYALLRKCLRNRNLRGISSVIIDEAHERTLYTDLLLGLLK
QCLACRPDLRIIITSATINPSVFIKYFNLPDGAVINVPGRAHPVKVIWSEHNISGRNTYV
SECVKTAVRVHKREPIGDILVFLTSPAEIDEAILLFKEMCAKENMSELMSLHGKSDVKDQ
MLVFETNTNGKRRIIFATNAAETSLTIPGIKYVIDSGMAKEMIFYPEKNKSCLMPTLINK
SSAEQRKGRAGRTQPGVCYRLYSKKDYESMPERALPELLKTDLLNALLKVYEFGIKPSSF
DFVESPSKEAIASSIESLEVLELIENNELTELGKQVVQLSIEPRLAKFILLGVESGMGHE
AAIIAALVSEAGRIFLKFDDNKEIADQRKKKFCQKNGDLCTFLEIYKRWLEVPQTDRFNW
CVSNYVSSKALNSARKTVKDILFTLRQDLGIKVSSRYNNLSFKENFETILFSSFIENLCI
YSGHPSFGYQSPNFKESLFIHPSSSVKNLRLEPPKFLVYTVFMETTRNFILDVTPLKEET
VNKAFSKGNYALTVKDLKRLQIPPITLGPFGEKILSRYILGKGGAVINNIKYLLEKLTKN
KHFRIDICRDKGLVIIHVEEKFHEKVSNFIQDIVNDAREEMAKETDVIKMDDGFYYYCLS
TGGLIHDIVMPGEFREIIIEQVVKSLLSELESMLKKCGPIQTFEINTLKTNKHSINVTYL
TVADAQNALRSLYKNNNKGIQVRNIVTEQVNNSSKPAYKLKFTWPRLLGKGTGSIFFSSA
EDRVMVSGKLSSKSLYVDSNRICVSPSQNELSLNLKNIPPSANERLLQEKISEALPHFLR
KLVKRVEINRMDTLAVAESDIIKIKDQLFQSLSRFTPPSKVMVDVMYPIATSRNYEAFAY
FSCAEDGKNAYQQLNDTLKVNNIPVTILETLQSQVKCKEYVYDFLQRDIHSVIKQQEGRV
KVTKLSDSFEDQVIIEFSCRSIEKHYIIIRELLRLVHGRKVECRGIRKYFHLFTDSGKKV
LDRIQAWTKTLIECDTEKKIVFIYGYSEMCFRAEAEIHSYIETAKLLKTKRYDLKSSDIP
PGFLKELYFRYGWDLYGLIKKFDLKAAKVDAEFGNLTIEGEVLKIKKVEDHLEEICSKLH
SKKTNEGDIGFGICAICLDFMKFDYYRLENCGHSFCKSCLLLQLESKIIPVACAQVKCRK
PFFLIDINRILSFGDKNLKQEFHNAALQHYVRTHFGKVSYCPTPECRSVYRVSSKYDVSF
HCLGCSNDICTYCQTFSHKGMSCKVYQNSKVDEDYSLKVWVKENKSCKL
NT seq 6450 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaatcttaaagaaataaaagctctaccagatgacttcagttttccagtttca
ttaagtgatgttaaaacagaagatgtagccagtagtgatcttagttatcttgcagtatca
acatccctgccaaaactaaataaaacttatgaagcctgtaagaaagagaatgaatctgag
aaaatttgccaagatcttaaatatcatgatagggaaagctatgtgtcacaaagagaccgc
aaaataggtattggtctttttaatatcaatgagattgaagatttaccaccaagacataaa
aagaaagttgtttcagcttatgagaaattaagatcatatgagatttatttgctaagtaag
aagtctgagtctaatgcctctagtatatcacctcctccaggattttttgatcctaaaact
gatcgtgatagtacttgtttagtatctaaatcaaccaaaaacctgaataactccatttca
aatgtgccaaaagtaaaagaaactcaagaacattcttttaacaatatgcttacagaatct
cagagtgataagtttagtaacgaccatatttataatacatcaaaacctaaatatacgaac
aacagttgtgaaaatatgcatcaagaaaatcattctcaaataaagatgaaaacacgacgt
tttgaatctcataaaaagtcaacaaataactgtgatgcttttaacaccttagttcctagt
gacagcgctatgcaatctacacatcacaaacataaatgttcattaaaaaactgtgaaact
gatcctgacattgatcacataagagatggctctgagaagtcagcagtatctattgaccgt
agagaaaggaataatcattattttcatgcaaatcatgtttacaatccgtcaacacaatat
ggtggacagaatgaagacttagatgtaaaaaattgtgaggattatgaaaatagtaagaaa
aatagtaaattaaaagttagtagagatactaattttcaaagcaaaaatgatcggtcaaac
cttaacagaaaccactatagaactcagaaatctaagtcaaaatattctattggtgaaaca
aaccaaaattcaaaacagtatacaactaaagaaagtaagcatgaggaatcttaccatagc
tttggttgtgaggatactaacttatcatttgctactgaaagtaattccgataatgctaaa
aaagaaagtagtcattatgatagtggcacatttagcaataggtctaaccttgccaataaa
agtaccaagcaaacttctgaaactatcgatttaaaaaaaatatattcagataaagaatgt
tatagatcaaatcattctcggaatgaaaagtttgaagggaaatgtttaaatttttatcaa
aacccagatacaaacaggggaattccttgtcgaaaaaggcattcaagcgatttatcaaac
acttcttactctgccttaagtgacaaaaacttcaaaggtaaatgtaattatgagcaacag
tcaacatattctgatcagaaagatgaaaatttttactctcaatcagcaagtcaaaaaact
cgtccttctaagcaaggtattttaagttcagacctttctcaaattttcagggacatcgat
agagttaaagctagagaagaaacaaaaattgatgccaaaagaatgcttagggttaaagat
gaaggatttttcttgcatatttctatatttgagccttctaatagtttagaaatgtgggaa
acatttttcaaaaaacatctcaaaatggaaaattttgaagtgagtaagtgctgtgatttt
actgagtctgtaattcttagttttaataatattaaaaatgctcatcaagctcattttcta
ctttataaattaaaacataaaacgaaagatacttctaagcgcttgattaaatctttgagt
agtattaagagacatctgattaaaccttgtatgtgtgaaaatgatgttattgagcattgt
gataaatattttgatgaatttgctgctaaatatatcagtattcaaaaagcgaaaatcaat
gcagttataggtgagttaaattcattacagatttcaaagtctaatattgtcaaagaggaa
aaatatttaagcttaaaagatactcttgataatttaaaagctatggagatagtatttcta
aactgtttaaggaagactaagaacgctgcagagaagttaaagaaagttgaagttgatggt
tctatgtcggacttcatggaattaaagctaaatttttgtaaagaatgtaactctttcgag
agaggtttacctatatattctcaaaaagatgttattctcaatgccattagaaactttcct
gtgactgttattgttgccgaaactgggtcaggaaaaagcacacagttaactcaatatctt
tggcaaacttattttgttaattatggttctattatttgtactcaacctcgaaaaatagcg
gcaattagtattactaagtttgtaagtactcaaattggatcttcagttggaaaagaagta
ggatatgatgttggaattgaaaagaagtttgacaattcaactaagattatttatatgact
gattatgccttattgagaaaatgtttacgaaatagaaacttaagaggaatttcctctgtt
attattgatgaagctcatgagcgaactctttatacagatttattacttggcttgttgaaa
cagtgcttagcatgtagacctgacttgagaattatcataacttcagcaactataaatccc
tctgtatttattaaatattttaatctacctgatggtgcagttataaatgttcctgggcgt
gcacaccccgttaaagtaatctggtctgagcataatataagtggaagaaatacgtatgta
agcgaatgtgtcaaaactgctgttcgggtgcacaaaagagaacccattggagatattcta
gtgtttttgacatcgcctgcagaaatcgatgaagctattttattatttaaggaaatgtgt
gctaaagagaacatgtcagaacttatgagtttgcatggtaaatcggatgtaaaagatcaa
atgcttgtttttgaaaccaatactaatggcaagcgtaggattatttttgcaacaaatgct
gctgagacttcattaactattcctggcattaaatatgtaattgacagtggaatggctaaa
gagatgatattttacccagaaaaaaataaaagttgcttaatgccaactttaattaataaa
agttctgctgaacagcgaaaaggtagagctggacgcacacaaccaggtgtttgctatcgt
ctatacagtaaaaaggattacgaaagtatgccagaaagagcccttccagagttgctgaag
acagatttacttaatgcattattgaaagtttatgaatttggtattaaacccagtagcttc
gattttgttgaatctccatcaaaagaagccatagcaagctcaatcgaatcattagaggtt
ttagaattgattgaaaataatgaattaactgagttaggaaagcaagttgttcaactttct
attgaacctagacttgctaaatttattctattaggtgttgaatctggcatgggtcatgaa
gctgctataattgcagctctagtttctgaagcgggaagaatatttttaaaatttgatgac
aacaaggaaatagctgatcaaaggaaaaaaaaattctgtcaaaaaaacggtgatctatgt
acttttttagaaatctataaaagatggctagaagtgccccaaacagatcgatttaattgg
tgtgtttcaaactatgtaagctccaaagcattaaactctgctcgcaagactgtcaaagat
attttattcactctgcgacaagatcttggcatcaaagtgtcaagtcgatataataactta
tcatttaaagagaattttgaaacaattctttttagcagctttattgaaaatttatgtata
tattcagggcatccttcctttgggtatcaatctcctaacttcaaagaatcattatttatt
catccttcctcatcagtgaaaaatctcagattagaacctcctaaatttttggtttataca
gtttttatggaaactacaagaaattttattcttgatgttacacccttaaaagaagaaaca
gttaataaggcattttcgaaaggtaattatgcattaactgttaaggatctaaaacgacta
caaattccacctataactttgggaccttttggagaaaaaattctgtctcgttacatttta
ggtaaaggtggcgctgtaattaataatattaagtatctgttagaaaaattaactaaaaat
aaacattttagaattgacatttgtagagacaagggattagttattattcatgttgaggaa
aaatttcatgaaaaagtgtctaattttattcaagatatcgtgaatgatgcaagggaggaa
atggcaaaagaaactgatgtcatcaagatggatgatggattttattactattgtttatcg
acaggtggattgattcatgatatagtaatgcctggagaatttcgtgaaattataattgaa
caagttgtgaaaagtttgttaagtgaattagaatcgatgttaaaaaagtgtggtcctatt
cagacctttgagataaatactttaaaaactaataaacatagcattaatgtgacatattta
actgttgctgatgcccaaaatgctcttagaagtttgtataaaaataacaataaaggtatt
caagttcgaaatattgttactgaacaagtcaataactcttctaaacctgcatataaactt
aagtttacatggcctcgtttgcttggaaaaggtaccggctccatatttttctcctctgct
gaggatcgtgtgatggtttctggaaaattatcttccaaatctttgtatgttgatagcaat
cgtatctgtgtatcaccctctcaaaatgaactctcccttaatttgaaaaatatacctcca
tcagcaaatgaaagactgttgcaagaaaaaatatcagaggcacttccacatttcttaagg
aagcttgtaaaaagagttgaaataaatcgaatggacactttagctgttgcagaaagtgat
atcattaagattaaagaccaattgtttcaaagcttaagtaggttcactccacctagtaag
gtaatggtggatgtaatgtacccaatagctacttccagaaactatgaagcctttgcttat
ttcagttgtgctgaagatggaaaaaatgcatatcagcaattaaatgatacgttgaaggtt
aataatattccggtaactattttggagacattgcagtcacaggtcaaatgcaaagagtat
gtttatgattttctacagagggatatacacagtgttatcaagcaacaggaaggaagggtt
aaggtaacaaaattgtctgattctttcgaggatcaagtcattattgaattttcttgtaga
agtattgaaaaacattacatcataattagagagcttttgagactggtacatggccgtaaa
gtggaatgccgtggtatcagaaagtattttcatctcttcactgatagtggtaaaaaagta
ttggacagaatccaagcttggacaaaaactctcattgaatgtgatactgagaaaaagatt
gtttttatatatggttacagtgaaatgtgttttagggctgaagcagaaattcattcgtac
attgaaacagcgaagttactcaagactaagaggtatgatctgaaaagctcagatatacca
ccaggatttttgaaagaactttattttaggtatggatgggatttgtatggtttgatcaaa
aaatttgatttaaaagcagcaaaggttgatgcagaatttggtaaccttacaattgaagga
gaagttcttaaaattaaaaaagttgaggaccatttagaagaaatttgttccaagcttcat
tcaaaaaagacgaatgaaggagatattgggtttggtatttgtgctatttgtctagatttc
atgaaatttgattattatcgacttgaaaactgtggtcattctttctgcaaatcctgtcta
cttttacagctagaaagtaagattattcctgtggcatgtgctcaagtgaaatgtagaaaa
ccattttttctcattgatataaatagaattttatcttttggtgacaaaaatcttaaacaa
gagtttcataatgcagctctgcagcattatgttcgtactcattttggaaaagtcagttat
tgtccaactcctgagtgtcgttctgtctatagagtttcaagcaaatacgatgttagtttt
cattgccttggttgctcaaatgacatctgcacatactgtcaaactttttcccacaaagga
atgtcttgcaaggtttatcaaaattcgaaagttgatgaggactactcgttaaaggtatgg
gtgaaagaaaacaaatcatgtaaactatga

DBGET integrated database retrieval system