KEGG   Parasteatoda tepidariorum (common house spider): 107436385Help
Entry
107436385         CDS       T06106                                 

Definition
(RefSeq) insulin-degrading enzyme isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptep01002]
    107436385
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     107436385
Peptidases and inhibitors [BR:ptep01002]
 Metallo peptidases
  Family M16: pitrilysin family
   107436385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 107436385
NCBI-ProteinID: XP_015903569
Position
Unknown
AA seq 1000 aa AA seqDB search
MANHDKLVSRVFDNIIKSQYDNRTYRGLELSNKMRVLLISDPSTDKSAAALNARVGFMSD
DPDLPGLAHFCEHMLFLGTKTYPVENDYTKFLHEHSGSSNAYTAADNTCYYFDVAPNSLS
DALHRFAQFFLCPLFTESATEREVNAVDSEHEKNLQSDTWRLAQLERATCDPNHDFSKFG
TGNKFTLFENPKSQGINIRDKLLEFHNKFYSSNIMSLIILGKETLEELENFVLPLFSDVS
NKNVQVPDWPKHPFSPEFLKLQGHVVPVKDIQNMNIAFPVPDLQNEYHSCPTSYLAHLIG
HEGPGSLLSELKSLGWANSIVSGYKPGAKGFAFFIVDLELTEEGIDHTDEIVTLLFQYLA
LLKKEGPQEWIFNERKNLNDITFRFKDREKPQSYVCSLASASFDYEMEDILCGSYIQTKY
KPELITKVLDLLIPDTIRIAVVGKKFSDICIKTEKWYGTKYHLDPIKEKVIQSWKNVTIH
PRLKLPLPNEFIPTNFELIPQENELFLFQMPKFPYLLRNTKMSRLWYKQDDYFLLPKACL
NFMLESAMAYVDPLHFNMTRLFVQLVRDSLNEYTYAADLAGIQYFLRCSKAGIFLNIKGY
TDKQHILLQKVMDKLTDLNFDQKRFDILKERLRRELKNFDAQQPHQHAMFYTSLIISEKI
WSNEELLNCLDDITIDKVKLMVPGLLGRVHIEALLYGNISKQKAIDLMSIVENGLQLKMG
SKYVMPGELLRDREIQLLDGVHLVYEVKNEVHNSSAVETYYQCGVQETRNNMLLELLVSV
VAEPCYNFLRTQEQLGYIVCSGTRRSNGAQGLRILVQSEKSPSFIDGKIESFIQYFEKYL
LELTEEEYKNHMDSLSLLRLEKPKKLSIQNTKYWMEISTKQYHFERDPLEVAVLATITKD
ELILFFKELVSCDAPKRKKLSVHILSTNCKSANDYIDGEFPCVPDLDPTNDGLIPPPPGF
RRPIKIENVNEFKNSSPLYPLVPPYIHIPCPLLKPEKAKL
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcatgacaaattagtttcccgtgtgtttgataacataatcaaatctcagtat
gacaaccgaacttatcggggattggaattgagtaataaaatgagagtattattaataagt
gatccttccactgataaatcagcagctgcattgaatgctcgagttggttttatgtcagat
gaccctgatttacctggtctagctcatttttgtgagcatatgttatttcttggaacaaaa
acgtatcctgttgagaatgattacactaagtttttacatgaacatagtggtagtagtaat
gcatatactgctgctgataatacctgttactactttgatgtagctcctaattctcttagt
gatgctttacacagatttgcccagttctttttgtgtcctttatttactgagagtgctact
gaacgagaagttaatgctgttgattctgaacatgaaaaaaatctacaaagcgatacttgg
aggctggctcagctagaaagagctacatgtgatcctaatcatgattttagtaaatttgga
acaggcaataaatttacattatttgaaaatccaaaatctcaaggaattaacattcgtgat
aagttgcttgaattccataataaattttattcttcaaacattatgtctctgattatcctc
ggcaaagaaactttagaagagttagaaaattttgttcttcctttgttttcggatgtctca
aataagaatgttcaagttcctgattggcctaagcatccatttagtcctgaatttttaaag
cttcaaggacatgttgtacctgtgaaggatatccagaacatgaacatcgcttttcctgtc
ccagaccttcaaaatgagtatcattcatgtccaacgtcatatttagcacatcttattggt
catgagggcccaggaagtcttttatcagaattgaaatctttaggttgggctaatagtata
gtttctggttataaacctggtgctaaagggtttgcattctttattgtggatctggaacta
actgaagaaggcattgatcacactgatgagattgtcacacttttatttcaatatcttgca
ttgctgaagaaagagggtcctcaggaatggatatttaatgaacgcaagaatttaaatgat
atcacatttagatttaaggatcgagaaaaacctcaatcttatgtttgttctttagctagt
gcttcttttgattatgagatggaggacattttatgtggttcttatatacaaaccaagtac
aaaccagagctgattaccaaggtcttagatttgctgattcccgataccataaggattgct
gtggtgggaaaaaaatttagtgacatttgtatcaaaactgaaaagtggtatggaaccaaa
tatcatttggatcccattaaagaaaaagtaattcagagctggaaaaatgtgactattcat
ccaagattgaaattaccacttcctaatgaatttatacctaccaactttgagttaattccc
caagaaaatgaattatttcttttccagatgcctaaatttccttatttgctaagaaatacc
aaaatgagtcggttatggtataaacaagatgattattttcttctaccaaaagcatgtctg
aatttcatgcttgaaagtgctatggcatatgttgaccctctgcatttcaatatgactcga
ctttttgtacaactagtaagagactcattaaatgagtatacatatgctgcagatttagct
ggaatccaatattttcttagatgctctaaagctggaatatttctaaatatcaagggatat
actgataaacagcatattcttcttcaaaaagttatggataaattgacggatttgaatttt
gatcaaaagcgttttgatattttgaaagaaaggttaagaagagagcttaaaaattttgat
gcgcagcaacctcaccaacatgcaatgttttatacatcactcattatttctgagaaaata
tggagcaatgaggaacttctcaattgcttagatgatattactattgacaaagtaaagttg
atggttcctggtctgttaggaagagttcatattgaagctttactttatggcaatatttca
aagcagaaagctattgatttaatgagcattgttgaaaatggattgcaattgaaaatggga
tctaaatatgtaatgcctggggagttacttagagatcgtgaaatacaactacttgacgga
gttcacttagtatatgaagtaaaaaatgaagttcacaatagctcggcggttgaaacatac
tatcagtgtggtgttcaagaaacaagaaacaatatgcttttggaactattagtttccgtt
gttgctgagccatgttacaattttctacgcactcaagagcagttaggctatatcgtatgc
agtggcacaaggcgttctaatggagcacaagggctaagaattctagttcaatctgaaaag
tcaccatcttttatcgatggaaaaatagagtcttttattcagtattttgaaaaatatctt
ctagagctaactgaagaggaatataaaaaccatatggattccctgtctttattacgttta
gaaaaaccaaaaaagttaagcattcaaaacacaaagtattggatggaaatatcaacgaag
cagtatcattttgagagagatccactagaagttgctgttcttgctacaattaccaaagat
gaattgattttatttttcaaggagctagtttcttgtgatgcaccaaaacgcaaaaagtta
tctgttcatatattatcaacgaattgtaaatctgcaaatgattacatcgatggagaattt
ccttgtgtgcctgacttggatccaacaaatgatggcttgattccccctcctcctggattc
aggcgaccaatcaaaatcgaaaatgttaacgaattcaagaattcctctccgttgtatcct
ttagtgcctccatacatacatattccttgcccactattgaaacctgagaaagcaaaactc
taa

DBGET integrated database retrieval system