KEGG   Parasteatoda tepidariorum (common house spider): 107438333Help
Entry
107438333         CDS       T06106                                 

Definition
(RefSeq) cell-death-related nuclease 7-like
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107438333
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     107438333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 107438333
NCBI-ProteinID: XP_015906091
Position
Unknown
AA seq 359 aa AA seqDB search
MPFLVYFLYICMCVSLDIKEAFAISCKNEQNQDIDWFILYKLPRLEESPHGSKYAYLTSS
DPNSWKLSSISITDENSMLGKTWKDLKRNENAATYLFYNDEPPKGFSGSAVGHLKGIVAF
DENTGFWMMHTVPKFGVISKYEYPNSGLKYGQYAFCVTYGTSQLNKISEHLLYCNPDIYL
YKTSESVVRQLTENSRTLFSEKPAFIHSSPFLKISTLQSIGNLEIKSFAKDNQLHQDLSS
DIIAPTLKTSLISETWQNGAGHALPASCQGKTHVLDAKSIKVNTIDKMGETQSFPFSSSD
DHSKWAVSIETDDDWICFADLNRMESQEKRGGGALCFQSRSVWKQFHDAVADTDMCPDA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccttgtatattttttatacatttgcatgtgtgtatctcttgatattaaagaa
gcctttgcaataagctgcaaaaatgaacaaaatcaagacattgattggttcattctctat
aagttacccagacttgaagaatctcctcatggatcaaaatatgcatatttgacatcatct
gatccgaattcttggaaattatcttcaatttccattacggatgaaaattcaatgttgggg
aaaacttggaaagatctgaaaagaaatgaaaacgctgcaacatatttgttttacaatgat
gagccaccaaaaggtttttcaggatcagctgtagggcacctaaaaggcattgttgcgttt
gatgaaaatacaggtttctggatgatgcacaccgtaccaaagtttggagttataagcaaa
tatgagtatccaaattccggacttaagtatggccaatatgctttttgtgtaacatatggt
acatctcagttaaacaaaatcagcgagcatcttttgtattgtaaccctgatatttacctt
tacaaaacttctgaaagtgttgttcgacaactaacagaaaattcaagaacattgttcagt
gaaaaaccagcttttatccacagttcaccatttctgaaaatctctacgcttcaaagcatt
ggaaatctggaaatcaagtcatttgcaaaagacaatcagttgcatcaagatttgtctagt
gatattattgcacctaccttgaaaacttctttgataagtgaaacatggcaaaatggagct
ggtcatgctttacctgcatcttgccaaggaaaaacacatgttcttgatgccaaatcaatc
aaagtcaataccattgataagatgggggaaactcagagttttccttttagttcatccgat
gatcacagcaaatgggcagtgtctattgaaactgatgatgactggatatgtttcgctgat
ttgaatagaatggaatctcaagaaaaacgtggcggtggtgcattatgttttcaatcaaga
tctgtgtggaagcagtttcacgatgctgtagctgacactgatatgtgcccagacgcatga

DBGET integrated database retrieval system