KEGG   Parasteatoda tepidariorum (common house spider): 107440487Help
Entry
107440487         CDS       T06106                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep03040  Spliceosome
ptep04141  Protein processing in endoplasmic reticulum
ptep04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107440487
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107440487
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107440487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptep01009]
    107440487
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptep03041]
    107440487
   03009 Ribosome biogenesis [BR:ptep03009]
    107440487
   03110 Chaperones and folding catalysts [BR:ptep03110]
    107440487
   04131 Membrane trafficking [BR:ptep04131]
    107440487
   03051 Proteasome [BR:ptep03051]
    107440487
   03029 Mitochondrial biogenesis [BR:ptep03029]
    107440487
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptep04147]
    107440487
Protein phosphatases and associated proteins [BR:ptep01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107440487
Spliceosome [BR:ptep03041]
 Complex B
  Other components
   Prp19 complex
    107440487
 Complex C
   Prp19-CDC5 complex
    107440487
Ribosome biogenesis [BR:ptep03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107440487
Chaperones and folding catalysts [BR:ptep03110]
 Heat shock proteins
  HSP70 / DNAK
   107440487
Membrane trafficking [BR:ptep04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107440487
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107440487
Proteasome [BR:ptep03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107440487
Mitochondrial biogenesis [BR:ptep03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107440487
Exosome [BR:ptep04147]
 Exosomal proteins
  Proteins found in most exosomes
   107440487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 107440487
NCBI-ProteinID: XP_015908911
Position
Unknown
AA seq 649 aa AA seqDB search
MATPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTETERLIGDAAKNQVAM
NPSNTVFDAKRLIGRRFDDSAVQSDMKHWPFDVVSDGGKPKIQVEYKGENKTFFPEEISS
MVLTKMKEIAEAYLGKTVINAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI
AYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF
VQEFKRKHKKDLTSNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYSTITRAR
FEELNADLFRSTLEPVEKALRDAKLDKAQVHDIVLVGGSTRIPKIQKLLQDFFNGKELNK
SINPDEAVAYGAAVQAAILNGDKSEQVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIP
TRQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDID
ANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVKDAEKYRDDDDKQKSRIAAKNS
LESYAFNIKSTIEDEKLKDKISDDDRKKVLDKVNDTLKWLDSNQLAEKEEFDDRQKELEN
ICNPIITKLYQSAGGAPGGMPGGFPGAGAGAGAAPGGGSTGGPTIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctgctattggtattgatttaggaacaacttattcttgtgttggtgttttt
caacacggaaaagtcgaaattattgcaaatgaccaaggtaatagaacaactccaagttac
gtcgcttttaccgaaactgaaagattgattggagatgctgccaaaaatcaagttgctatg
aatcccagtaacacagtttttgatgctaaaagattaatcgggcgacgttttgatgattct
gctgttcaatctgatatgaaacattggccttttgatgtcgtcagcgatggaggcaagccc
aaaattcaagtagaatacaagggtgagaataagacctttttccctgaagaaatctcttct
atggttctaactaaaatgaaggaaattgctgaagcatatctaggaaagactgtaatcaat
gctgttgttaccgttcctgcctatttcaatgattctcagaggcaagccacaaaggatgcc
ggtactattgctggacttaatgttcttcgaattattaatgaacctactgctgctgctatc
gcttatggtctagacaaaaaaggaactggtgagcgaaatgttcttatctttgatttgggt
ggtggcacctttgatgtatctatccttactattgaagatggtatctttgaagtaaagtcc
actgctggggacactcatttgggtggtgaagattttgataatcgcatggtcaatcacttt
gtccaagaatttaagagaaagcacaaaaaagacttaacctcaaacaaaagagctctaaga
agattgcgaactgcctgtgaacgtgcaaagagaaccctgtcttctagtactcaagcaagt
attgaaattgattctctcttcgaaggtgttgacttctactccaccatcacaagggccaga
tttgaagaactgaatgctgaccttttccgaagcacccttgagcctgttgagaaagccctt
agagatgcaaaactagataaagctcaagtccatgatattgtattggttggagggtccaca
cgtattcccaagatccaaaagctccttcaagatttcttcaatggtaaagaattgaacaag
agtattaatcccgatgaggctgttgcttatggagctgctgttcaagctgctattttgaat
ggtgacaagtctgaacaagttcaagatttgcttctgttagatgtaactcccctttccctt
ggaattgaaactgctggaggtgtcatgactgttctgattaagcgaaacacaacaatccct
acccgacagacccaaacattcaccacttactctgataatcagcccggagtacttattcaa
gtatatgaaggtgaacgtgccatgacaaaggacaataacttattaggaaaattcgaactc
actggtattcctcctgctcctcgtggcgtgcctcaaattgaagtaacttttgatattgat
gctaatggtatcttgaatgtatctgctgttgataaaagcactggtaaagaaaacaaaatc
actatcaccaacgacaaaggcagattatctaaagaagaaattgaaaggatggttaaagat
gctgaaaaatacagagatgatgacgacaaacaaaagagcagaattgctgctaagaactct
cttgaaagctatgcattcaacattaagtcaacaatagaagatgaaaagcttaaagacaaa
atctcagacgacgataggaaaaaggttttggataaagttaatgatactttgaaatggtta
gacagcaatcagcttgccgaaaaggaagaattcgatgacagacaaaaagaacttgaaaac
atttgcaatcctatcatcacaaaactgtaccaatctgctggtggtgctcctggaggcatg
cctggtggtttccctggtgcaggcgctggagctggagctgcacctggcggaggcagtact
ggtggaccaacaattgaagaggtggattaa

DBGET integrated database retrieval system