KEGG   Parasteatoda tepidariorum (common house spider): 107442858Help
Entry
107442858         CDS       T06106                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107442858
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptep03041]
    107442858
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107442858
Spliceosome [BR:ptep03041]
 Complex C
  Other components
   Step II factors
    107442858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBR HA2 SLS DUF1664
Motif
Other DBs
NCBI-GeneID: 107442858
NCBI-ProteinID: XP_015912005
Position
Unknown
AA seq 1984 aa AA seqDB search
MDSEESFTSSDSDWEDVEDTKAMKNDVRSCNSEPTDHTMNPESHLGCDASKKNPCTIIKQ
TARKSKNKTKFGKKGKFLKSNSKSSIAKSEKIDSRTSVLSRLSSSEAEAPIRKFDPIPDS
LYMNKEKFQLSESPEKLTIPFSMSMTNRNNYDLNDSADELSQSPPRFNSCYIQKDENSTN
SQSIRFHSENEGNTYFGSDSGSDSDSKNSLFSWSFSERPVNKEKHTKRSTSLFESSDAKT
TRQLGSSSSKNHIPDPCKTPKTYHLSSEYLQQVNCQSYERKPASISPELPSATVKLATAV
QRNEKNSPHQLHFDPQDIKMKQQFSKIEIDNEAKRKGLFSERKPPTRFSQASLRNDKFDI
LHQEIQNRNSFDQDIPTHIKMKQQYSEIDNEAKRKELFYKRQPPTNFSQVSLTSEKFDIV
HQEIQNRNSRPFITDNQVRSSDQNVKQQYLGKRIDYDSEKSSTNRRESSNNPLSSNYEIY
PNDITHLTTEDDELNLNSLDFISCCRKELEKISEEAINKVSSKKEDLRSISESENTKIKN
ILTKRIENFDSQQNQFIDIITHAKNQISYTSCQNYEDIVKTWDAIKSTVQNESKLFENFF
PAYAYRDEVVQSLNHKRILFLHSSNAYFFNILVPLISLKHYPSCFIVSCVSGETQKQYLK
YSLHSAMGSKEQKHKTYVMTESELLNYSLKIDYAAKKTTCVVLNLPLSRSVVTDILLSNL
RDILKENKNSKLVLIIDPVVNLTPYKKYFSMFEISTIVPPNLTYPVNTIWKNNALVPEND
ILNEIVRTILSIHITKSWGNILAFVPSLRDAKTVNQLLKKQCAVYQYNSVKIILVEENYY
AICSDEIREKNSKFQFVFISVGSAEMISLPSVHFIVDCGTVTDYHLDDNKKVDVLATVFI
SSVKSKLRKTLGGVYGPGMCYRIYSKHNFINDMPSQDYPELLLRNPLNSLVKILKYKPDV
VLKEFIEFLPEGVVAETIRNLEKYGAIVDNKVSLIGEKLIKLPFEAKYSKLILLGIESGL
ALETVVLVSFLTEKGKLFKSTDNPKYQRIIDAKQMELVQHQSDTLTNLHIYKTCLRNKFD
LEWCKTHYIDDNFLKRVHQRVEEMREIIFSSLEIKISENFSNNENWPMIVREIIYDCFRD
NLCVFSGRLDCGFRVLSSKSVAYLPTQSIICQKDNVPQFLIFDHVLLSDKNYLINVTSIP
SDFVMKSLQDGSSYFSDNELFDYTLTKRTIEPVGEEVMNDIFLGEDDEKLKLVIEQIKQK
TGIDLISIEPSVEKGSVSIYAFPTCIDAAYEALKKILKTKSEEIINECQTHSYELVKDDK
SVILEVELAKGAMAKYVKVGEILIQPLTVANVHSAGIFTSAAKQYNRFPYSLHIAWIRRH
CNGNANVDFGENTNFSSVRRLSLRHLYFLGMEIFMEMSERKKNQLCISGLSPEICQEKLK
DELKILLPAAEITHIELMRIAPFETSDKRLKAIKSSISNICKNALDMSSTEIVLSKPKPS
DIIQELYIKTNTYEGLDSVADLVKIKFLEDKLSITTLAFNLRIICNNYIYQALQSQLNST
LSELKNDLSQGNAKADFEINVGKGSEETYFIDVSATNVAVLNLVHETINCLLNGVILNEN
DIKDLDKMFCHGGHVWLKGLEASENLYIIMNRQRKVLRLYGAEVNCENAKKRLIQYLKDI
ENDVNDIIELSSEKTKNFLLKALVQKYGIDLKKFIEECKLHQAYLDLRTAKLYVYGDQTS
VEEASNCIQNLLENLDSVNSEAILYQEICPVCLCPAINLTYRLEHCGHLYHSEPCIQQFM
ENNEDFPIKCSTEGCEKELVLKDIWKMLRNNPERMKSLIKKSIANYLERHVLEVVLCPTP
DCSMFFYKSEILGDKTHCGLCQNDICIKCHCIEHSGFTCQMYEGTKKDADYSYKVWAQTA
NCKRCPRCKTAIEKSEGCNHMTCRNCSGHFCWLCPSETAQVWATGNECYAHINRAHTGQL
FDYN
NT seq 5955 nt NT seq  +upstreamnt  +downstreamnt
atggactcagaagaatcattcacgagttccgattctgattgggaagatgttgaagatact
aaagctatgaaaaatgatgtcagatcttgtaactcagagcctaccgatcacactatgaac
ccagagtctcacttgggttgtgacgcttcaaagaaaaatccttgcacaatcataaaacaa
actgctaggaaatcaaaaaataaaacgaagtttggtaagaaaggtaagtttctaaagtct
aattccaaatcaagcattgctaaatcagaaaaaattgattcaaggacatctgtgctctct
agactctcttcatctgaagctgaagctcctattcgcaaatttgacccaattccagatagc
ttgtatatgaataaggaaaaatttcaactttctgaaagtcctgagaaattaactatacca
ttttctatgagtatgaccaatagaaataattatgatttgaatgactcagctgatgaactt
agtcaatcaccaccccgatttaattcctgttacatccaaaaggatgaaaactctactaat
tctcaaagcattagatttcattctgaaaatgaaggaaatacatactttggatctgattct
ggttcagattctgattcgaagaactcactttttagttggtcgttttctgaaagaccagtc
aataaggaaaagcatactaaaagaagtactagtttgtttgaatcttctgacgcaaagacc
actcgtcagcttggcagtagttcttcaaaaaatcatattccagatccttgcaaaacacca
aaaacttaccatctaagttctgaatatttacaacaagttaattgtcaaagttatgaaagg
aaaccagcttcaatctctcctgaacttccatcagcaactgtaaaacttgctacagctgtt
caaagaaatgaaaaaaatagtcctcatcaattgcatttcgatcctcaagatattaagatg
aaacagcaattttctaaaatagaaatagataatgaggcaaaaagaaagggattattttct
gaaaggaaaccaccaactcgcttttcacaagcctcattaagaaacgacaaatttgatatt
cttcatcaagaaattcaaaacaggaattcttttgatcaagatattcctacccatattaag
atgaaacagcaatattctgaaatagataatgaggcaaaaagaaaggaattattttataaa
aggcaaccaccaacaaacttttcacaagtctcattaacatcagaaaaatttgatattgtt
catcaagaaattcaaaacaggaattctcgcccatttattactgataatcaagttagatcg
agtgatcaaaatgttaaacagcaatatttaggtaaaagaatagattatgattcagaaaaa
agttctacaaatagaagagaatcttctaacaatcctttatcttcaaactatgaaatttat
ccaaatgatatcacacatttaactaccgaagatgatgaactaaatttgaattccttggat
tttattagttgttgtagaaaagaattagaaaaaatttctgaagaagctatcaataaagtt
tcatcaaaaaaagaagatttaagatcaatttctgagagtgagaacactaagatcaaaaat
attttaacgaaacgtattgaaaattttgattcacaacagaatcaatttatagatataata
acccatgcaaagaatcaaatatcttatacatcgtgtcaaaattatgaggatatagttaaa
acgtgggatgcaatcaaatccactgttcaaaatgagagtaaattgtttgaaaactttttt
ccagcttatgcatatcgcgatgaagtagtccaaagtttaaatcacaagcgcattttattt
ttgcattcaagcaacgcttatttttttaatatcttagtgccattaatatctctaaaacat
tatccaagttgttttattgtgtcttgtgtaagtggtgagacccaaaagcaatatctgaaa
tattctcttcattcggcaatgggaagcaaagaacaaaagcataaaacttatgtcatgaca
gaatcggaacttttaaattattctcttaaaatagattatgcagccaaaaaaacaacttgt
gttgttttgaatctccctctttctagatcagtagttactgacattttgctatcaaattta
agagatatcttaaaagagaataagaattcgaagcttgttttaataattgatccagttgtg
aatttgacaccctacaaaaaatatttctccatgtttgaaatctcaacaatagtaccccct
aatcttacgtatccagtgaataccatatggaaaaacaatgctttggtccctgaaaacgat
attttgaacgaaatagtgcgaacaatattgtccatccacatcacaaaaagttggggtaac
atacttgcctttgtaccatcattaagagatgcaaaaactgtcaatcaattgctcaagaaa
caatgtgcagtttatcagtacaatagcgttaaaattattttggtggaggaaaactattat
gctatttgcagtgatgaaatacgtgagaaaaattctaaatttcagtttgtttttatatca
gttggttctgctgaaatgataagtcttccgtctgtgcacttcattgtggattgtggtact
gttacggactaccacttggatgataacaaaaaagtcgatgttttagccacagtatttatt
tcttctgtcaaatcaaaactgcgtaaaactttaggtggagtttatggccctggcatgtgt
tatcgaatttacagcaaacataacttcattaatgatatgccttctcaagactatcctgag
cttttgcttagaaatcctcttaattctttagtaaaaattctcaagtataagccagatgtc
gtgctgaaagagtttattgaatttctacctgaaggtgtggtagcagaaacaattagaaac
ttagaaaaatatggtgctattgtggataataaagtttcactcattggagaaaaattaatt
aaacttccttttgaggctaagtattcaaaactaatacttttgggaatagaatctggtttg
gcattagaaacagttgtccttgtgtcttttttaactgaaaagggtaaattgtttaaaagt
acagataatccaaaatatcaacgtataattgatgctaagcaaatggaactagttcaacat
caaagtgacactttaaccaacctgcatatttataaaacctgcttaagaaacaagtttgat
ttagaatggtgcaaaacacattacattgatgataattttttaaaaagagtacatcaaagg
gttgaggaaatgcgtgaaattatattttcgagtttagaaataaaaattagtgagaacttc
tcaaataatgaaaactggccaatgatcgtccgtgaaataatatatgattgctttcgagat
aatctttgtgtctttagtggtcgtttagattgtggtttcagagtgcttagctctaagtca
gtggcatatctacccactcaatctataatttgtcagaaggataacgtacctcagttttta
atttttgatcatgtactattatctgataaaaattacttgattaatgtcactagtattcct
agtgattttgtaatgaaaagtttgcaggatggatcgtcatatttttctgataacgagctt
tttgattatactttaacgaagcgaacaattgagcctgtgggtgaagaagtaatgaatgat
atctttcttggtgaagatgatgaaaaactaaaacttgtcattgaacaaattaaacaaaaa
acaggcattgatctgatttcaattgaaccatccgtagaaaaaggctctgtctctatctat
gcttttcctacttgtattgatgctgcttatgaagccctcaaaaaaatcttgaaaacaaag
agtgaagagattataaatgagtgtcaaacccattcatatgaattagtgaaggatgacaag
tctgtgatacttgaggttgaattggctaaaggtgcaatggctaaatatgttaaagttggt
gaaattcttatacaacccttaactgtggcgaatgtgcattctgcaggaattttcacatct
gcagctaaacagtataatagatttccatattctttgcatattgcttggattcgaagacac
tgtaatggaaatgctaatgtagattttggcgaaaacactaacttctccagtgttcgtaga
ctttccttaagacacttatatttcctggggatggaaatatttatggaaatgagtgaaagg
aaaaaaaatcaactgtgcatttcaggtctgtcacctgaaatatgccaagaaaaacttaaa
gacgagttgaaaatattgttacctgctgctgaaattacgcatattgaattgatgcgtatc
gcaccatttgaaacatctgacaaaagacttaaggcaataaaatctagtatttcaaatatt
tgcaaaaatgctttagatatgagttcaacggaaattgtactctctaagccaaaaccttca
gacataattcaagaattatatattaaaacaaatacttatgaggggttagattctgttgct
gatttagttaaaatcaaatttttggaagacaagctaagtattaccacactagcattcaat
cttagaattatctgcaacaattatatttatcaagcattacaatctcaactgaattcaact
ctctctgaattaaagaatgatttaagtcaaggtaacgcaaaggctgattttgagataaat
gttggcaaagggagtgaagaaacttattttattgatgtatctgcaactaatgttgctgtg
ttaaatttagttcatgaaacaatcaattgtttgctgaatggtgtgatattaaatgaaaat
gatataaaagatcttgataaaatgttctgccatgggggacatgtttggttaaaaggtctt
gaagcaagtgaaaatttatatatcattatgaatcgacaaagaaaagtgttgcgattatat
ggagctgaagttaactgtgaaaatgccaaaaagcgccttatacaatatctcaaagatatt
gaaaatgatgtgaatgacatcattgaactatctagcgagaaaacaaaaaattttcttttg
aaagctcttgtccaaaagtatggtattgacttaaagaaatttattgaagagtgtaaactg
caccaagcttaccttgatctcagaactgccaaactatatgtttatggtgatcagacaagt
gtcgaagaggcttcaaactgcattcaaaatttgttagaaaatctagattcagtgaattca
gaagcaatactttaccaagaaatttgtcctgtctgtctttgtcctgctatcaatttaact
tacaggcttgaacattgtggtcatctatatcacagtgaaccttgtatacaacaatttatg
gaaaataatgaagattttcctataaaatgttcaacagagggttgcgaaaaagaattagtt
ttgaaggacatttggaaaatgctgcgaaataatcctgaaagaatgaaaagcttaattaaa
aaatctattgctaattacttagagcgacatgttttagaagttgtactttgccctactcca
gactgctcaatgttcttttataaatctgaaatactaggtgacaaaacacactgcggattg
tgccaaaatgatatttgcattaagtgccattgtattgaacatagtggttttacttgtcaa
atgtatgaaggaactaaaaaagatgctgattattcttataaggtgtgggctcaaacagca
aattgcaagaggtgtcccagatgtaaaacagctattgaaaaatctgaaggctgtaatcat
atgacatgtagaaattgcagtggtcatttttgctggttgtgcccctctgaaactgctcaa
gtatgggccactggaaatgaatgttatgcccatattaatagagcacatactggacaatta
tttgattacaactga

DBGET integrated database retrieval system