KEGG   Parasteatoda tepidariorum (common house spider): 107443708Help
Entry
107443708         CDS       T06106                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107443708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptep03041]
    107443708
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107443708
Spliceosome [BR:ptep03041]
 Complex C
  Other components
   Step II factors
    107443708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_22 AAA_30 T2SSE AAA_19 PhoH DUF2075 Helicase_RecD Flavi_DEAD AAA_7 ABC_tran
Motif
Other DBs
NCBI-GeneID: 107443708
NCBI-ProteinID: XP_015913147
Position
Unknown
AA seq 921 aa AA seqDB search
MAELRKLEYISVVKNIATELYNHLGISDTDLAEFVISLAEKNDTHETFKRALEENGATFS
DSLIASVLRRIKTMMPKRSLEAEDPSEMSAASRSEENLHFSVIATNDDKVKKPTSSCLHI
PELPIHDVDTSEESKEEDDEDIEIELVKDNPPFLSLLDVENVQDLTPIRIVKNPDGSLAQ
GAMIQSALAKNRREQRLQQRDAERNSITTELSKQWIDPLPHAEGIKSSGLSTDDFPEWKK
HIIAGPKVSYGKKTQLSLLEQRQSLPIYKLKDDLVKAITENQILIVIGETGSGKTTQMTQ
YLAEAGFTAKGKIGCTQPRRVATSSVAKRVAEEFGCRLGQEVGYYIRFEDCTSSETVIKY
MTEGMLLKECLNDPDLKSYSVLMLDEAHERTIYTDVLFGLMKKAVKRRPELKLIVTSATL
DAVKFSQYFFEAPIFTIPGRTYPVEILYAKEPEKDYLDASLTTVMQIHLSEPAGDILVFL
TGQEEIDTACEVLYERMKSLGPKAPELLILPIYSALPGEMQTRIFEPTPIGLRKVVIATN
IAETSLTIDGIYFVVDPGFVKQKSFDSKTGMESLVIIPISQAQAKQRAGRAGRTGPGKCY
RLYTERSYRDEMLTTPVPEIQRTNLAYTILQLKAMGINDLLSFEFMDAPPQVSLIMALQQ
LYSLSVLDSEGLLTRLGRRMAEFPMEPNLSKMLIMSVQLGCSEEILTIVSMLSVQGVFYR
PKDKQALADQKKARFHQPQGDHLTLLAVYNSWSNNKFSKAWCYENFIQFRTLQKAQDIRK
QLLGIMDRHKFDVLSCGKKTAQIQKAICSGFFRNVAKKDHQDGYRTLVDGQVVYIHPSSA
LFNREPEWVIYHEVVQTTKEYMRDVTAVDPKWVVDFAPAFYKFADPTKLSAQKKQLRLEP
LYNKYEEPNAWRISRTKRRRN
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattacgaaaattagaatatatttcagttgtgaaaaacattgctactgaactt
tataatcatttaggaattagcgacacagatttagctgaatttgttatatcattagctgaa
aagaatgatactcatgaaacattcaagagagctttggaagaaaatggtgctactttttcg
gattcattaattgctagtgtgttgcgtcgcattaagactatgatgccaaaaagatcattg
gaggcagaggatccatcagaaatgagtgcggcttccagaagcgaagaaaatcttcatttt
tcagttattgctactaatgatgataaagttaagaagcctacctcaagttgtttgcacata
cctgagctacccattcatgatgtagatacaagcgaggaatcaaaagaggaagatgatgag
gatattgaaattgaacttgttaaggataatccacccttcttgtctttgcttgatgtggaa
aatgtacaagatcttacacctatcagaattgttaaaaatcctgatggttctttagctcaa
ggtgccatgatacaatcagccctcgcaaaaaatagaagggagcaaagactgcaacaacga
gatgctgaaaggaattctattactactgaattgagcaaacaatggattgatccattacca
catgctgaaggcataaaaagttctggattgtctactgatgattttcctgaatggaaaaag
catataatagctggccctaaagtgtcttatggcaaaaagacccaattgagtttattagaa
caaagacaaagccttcctatttataaattaaaagatgatcttgtgaaggctattacagag
aatcaaattcttattgtcattggggaaactggatctggaaaaactacccagatgactcaa
tatttggcagaagctggttttacggcaaagggaaagattggttgcactcaacctagaaga
gttgcaacttcgtcagttgcaaagagagttgccgaggaattcggttgccgattaggccaa
gaggtaggctattacatccgttttgaagattgcacgagttctgaaacagtcattaaatac
atgacagaaggtatgcttttgaaagagtgtctgaatgatccggacctgaaaagttactca
gtattgatgctggatgaagctcatgaaagaacaatctatacagatgtattgtttggactt
atgaagaaggctgtgaaacgaagacctgaactcaaactgattgttacatctgctaccttg
gatgcagtaaagttttctcagtatttctttgaagcgccaatattcacaatacctggacga
acttaccctgttgaaattttatacgctaaagaaccagaaaaggattatttagatgcttct
ttaactacagttatgcagattcatctttctgaacctgcaggtgatatattggtttttctc
actggtcaagaagaaattgacacagcttgtgaagttttgtacgaaagaatgaaatcttta
gggccaaaagcacctgaacttttaatacttcccatttattcagcattgcctggtgaaatg
cagacaagaattttcgaacccactcctattggattgagaaaggttgtaatagctacgaat
attgctgaaacatcccttacaattgatggaatttattttgtagttgacccaggttttgta
aagcagaaatcatttgactcaaaaactgggatggagtcattagttattatacccatatcc
caggctcaagctaagcaaagagcaggccgtgcaggaaggacgggaccaggaaaatgttat
cgtctctacactgagaggtcatacagagatgaaatgctgaccactccagtaccggagatc
caaaggacaaatcttgcatacactatactgcagctaaaagcaatggggattaatgatttg
ctctcatttgaatttatggatgctcctcctcaagtgtctctgattatggctttacagcag
ttgtattctctcagtgttctggatagtgaagggcttttgactagacttggacgacggatg
gcagaatttccaatggaaccaaacttatcaaagatgcttataatgtcagtgcaattgggt
tgcagtgaagaaattcttactattgtatctatgttgtcagttcaaggcgtattttatcgg
ccaaaggacaaacaagctttagctgatcagaaaaaagccagatttcatcagcctcaagga
gatcatttaactttactggcagtgtacaattcttggagcaacaacaaattttccaaagca
tggtgttatgaaaatttcatacaatttagaacactacaaaaggctcaagatattcgcaaa
cagctgttggggatcatggataggcataaatttgatgttctgtcctgtggtaagaaaaca
gctcaaattcagaaagctatctgcagtggattttttagaaatgttgccaagaaagatcat
caggatggttacaggactcttgttgatggtcaagttgtttacatccatccatccagtgcc
ttattcaaccgagaacctgaatgggttatttatcacgaagtagttcagactactaaggaa
tacatgagagacgtaacagctgtcgatccgaagtgggtggtcgattttgcaccggcattc
tacaaatttgctgacccgactaaactgagtgcacaaaagaaacaactcaggttggaaccc
ttgtacaacaaatatgaagaacctaatgcttggaggatatctagaaccaaaagaagaaga
aactaa

DBGET integrated database retrieval system