KEGG   Parasteatoda tepidariorum (common house spider): 107445145Help
Entry
107445145         CDS       T06106                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ptep00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ptep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107445145
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107445145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptep01003]
    107445145
Enzymes [BR:ptep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     107445145
Glycosyltransferases [BR:ptep01003]
 Glycan extension
  P blood group
   107445145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 107445145
NCBI-ProteinID: XP_015914970
Position
Unknown
AA seq 340 aa AA seqDB search
MARLLRVIQKATVLLFSFALLYLAYCSLSDYNNIETYEIRYNQSCRADSALFNAADFVIC
IEKPHIFFVETSSSTVLTPRQACAVESTARHNPDSPVAVLMTPSESIDTSHLLSKTLQNI
PNIHLIKINIADLTQGTPIQKWYLLGQWKKSKWKFSHLSDALRYFLMWKYGGVYLDLDIV
TLRSLQKLKNTVITENWDRVAAGLLFFDKGHELMKRCMHDFAANYDYSNFVMNGPGIITK
NIKFLCDTEKISKVSGANCKVDIQPPESAFPIPYDEWEAYFIPSTVTDVTKHFNSSYLIH
VWNKYSQHSKLMIGLNSLYELAMKEHCPSVYKYAQTIGRI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcttctacgagttattcaaaaagccactgtactgttattttcatttgcattg
ctatatttggcttattgttcactctcagattataataacatagaaacttatgagataaga
tataaccagtcatgcagagcagacagtgcattattcaatgctgctgattttgttatatgc
attgagaaacctcatatattttttgtggagacttcttcatcaactgttttaactcctcgc
caagcatgtgcagttgaatcaacagcaaggcacaatcctgattcccctgtggctgtactc
atgacaccatctgaatcaattgatacctctcatctgctgtctaaaactctacaaaatatt
cctaacattcacctaataaaaataaacatagctgatctcactcagggtacacctatacag
aaatggtatttacttggccaatggaaaaaaagcaaatggaagttcagccacttaagtgat
gctttaagatatttcctgatgtggaaatatggaggtgtctatctggatttggatatagtc
acattacggtcgttgcagaagctgaagaacaccgtcatcaccgaaaactgggatcgcgta
gccgctggattattattctttgacaagggccatgaactgatgaaacgctgtatgcatgat
tttgctgcaaattacgactactccaactttgtcatgaatggacctggtattataaccaaa
aatattaaatttctctgtgatactgaaaaaattagcaaagtgtctggtgccaattgtaag
gttgatatccaacctcctgaaagtgcttttcctattccttatgatgaatgggaagcatat
ttcataccttcaactgtaactgatgtaacaaagcacttcaattcaagttatttaatccat
gtatggaataaatacagccaacattcaaaactgatgattgggcttaacagtttgtatgaa
ctggcaatgaaagaacactgcccttctgtttataaatatgctcaaacaataggacgtata
taa

DBGET integrated database retrieval system