KEGG   Parasteatoda tepidariorum (common house spider): 107448187Help
Entry
107448187         CDS       T06106                                 

Definition
(RefSeq) autophagy-related protein 16-1
  KO
K17890  autophagy-related protein 16-1
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep04136  Autophagy - other
ptep04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107448187
   04136 Autophagy - other
    107448187
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptep04131]
    107448187
   03029 Mitochondrial biogenesis [BR:ptep03029]
    107448187
Membrane trafficking [BR:ptep04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    107448187
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    107448187
Mitochondrial biogenesis [BR:ptep03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107448187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 DUF3461 YabA HALZ YjcZ
Motif
Other DBs
NCBI-GeneID: 107448187
NCBI-ProteinID: XP_015918788
UniProt: A0A2L2YG83
Position
Unknown
AA seq 538 aa AA seqDB search
MGSNELKSCILSQLKRRNFKEHSFQELIQYSNKLLESLDYLKKETRKIQTESIPLESLRH
PEGSKLEDSNLLAKYHGLQEELKQCHIKISEFAQQVLELKNVVDEKNSLLCKLNNELENT
RTELKTSNEINEKYLRQLTNMKSVLQDKIDEFDALNITFSSVENKNNDLEIEMKKLKEEI
LSLKSLGRSSGSSESLRSASITSALMSAANDISVGKSARNEAAEKRESSSPKSKPRQHFT
STLPSKVKHDLIAHDSEVNAVVWLPKMSCFLTGGSDRKVKFWEMCDSGIELRENIRGCNS
SILSIDVDPEANLLLCASSDFASRVWTMWDFMIRHTLTGHSGKVTSSKFMSETNRIVSGS
SDQTLKLWDLRQRVCIVTYGTNAPVNDVISRPSNFVISGHTDKKIRVWDPRVGNEITHLA
CSKAVTSLDLSRNGYLLLASERGECLKLFDLRVFKETFSLQEPGFEIACDLTRAKFSPDY
KYCCCGSKNGSIYLWNVASGKLEKQLKGHNSSVTSCCWSSCGSYLASCDKNRHCLIWS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaacgaattgaaatcatgtattttatctcaacttaaaagaagaaatttcaaa
gaacacagtttccaagaactcattcagtacagtaataagttattggaatccttagattat
ttgaaaaaagagactcgaaaaatacaaacagagtccattcctcttgaaagtttgcgccac
ccagaaggttctaagttagaggattcaaatttacttgcaaagtaccacggcttacaagag
gaactgaaacaatgccatattaaaatttctgagtttgcgcagcaagttttagaattaaaa
aatgtggtggacgaaaaaaatagtttgctatgtaagctaaataatgaattagaaaatact
cgaacagagcttaaaactagcaatgaaattaatgaaaagtatctgaggcaactgacaaat
atgaaatctgttttacaagacaaaattgatgaattcgatgccttgaatatcacattttcg
agtgttgaaaataaaaacaacgatttggaaatagaaatgaaaaagttaaaagaagaaatt
ctgtcactgaagagtcttggtagaagttctggtagttctgaaagccttagatcagcttct
attacgtctgccttgatgtctgcagcaaacgatattagtgttggtaaatcagctagaaac
gaagcagctgaaaaaagagaatcttcatcaccaaagtcaaaacctagacaacattttact
tcaacattgccttcaaaagtaaagcacgatttaatcgcgcacgacagcgaagtaaacgct
gttgtatggttgccaaaaatgtcgtgttttttaactggtggatcagatcgcaaggttaag
ttttgggaaatgtgcgatagtggcatcgaattgcgagaaaatattcgtggctgtaattct
tccattctttccattgatgttgatccagaagcaaatttattgttatgcgcatcttctgat
tttgctagtcgtgtatggacaatgtgggatttcatgatacggcatactttaactggacac
agtggtaaagttacttcttcgaaatttatgagtgaaactaacagaattgtatctggcagc
tctgatcagacgttaaaattatgggacttgcgtcaaagagtttgtattgtgacctacggc
actaatgctcctgtaaatgacgtaataagcagacccagcaattttgtgattagtggtcac
acggacaagaaaatacgcgtttgggatcctcgtgttggaaatgagattactcacctagca
tgttcgaaagctgtgacgtctttggatttatccagaaatggctatctacttctagcttca
gagcgtggcgaatgcttgaaactattcgatttaagagtttttaaagagactttttctttg
caagaacctggttttgagattgcctgcgatttaactcgcgctaaattcagccctgattac
aaatattgttgttgcggttctaagaacggttctatttatttgtggaatgtggcatctggt
aaacttgaaaaacaattaaaaggtcataactctagtgtaacatcatgctgttggagttct
tgtggctcatatttagcaagctgtgataaaaatcgacattgccttatatggagctga

DBGET integrated database retrieval system