KEGG   Parasteatoda tepidariorum (common house spider): 107449802Help
Entry
107449802         CDS       T06106                                 

Definition
(RefSeq) L-xylulose reductase-like
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep00040  Pentose and glucuronate interconversions
ptep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107449802
Enzymes [BR:ptep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     107449802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 Sacchrp_dh_NADP RmlD_sub_bind 3Beta_HSD Shikimate_DH Polysacc_synt_2 THF_DHG_CYH_C RNA_pol_Rpb1_4 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 107449802
NCBI-ProteinID: XP_015920943
Position
Unknown
AA seq 243 aa AA seqDB search
MSSSFKNKRVLVTGAGRGIGRAIVKELVSKEASVIALSKTKANLDNLKKEFPSIEIVAVD
VGNWKETEAAVQKLGAIDMLVNNAGIITLQEVGSITEDEVDECFSVNVKAVANISQIVAV
NMKKAGIRGSIVNLSSQASMVGIPKHATYCASKGAVDQLTKVFALELGPSGIRVNSVNPT
VILTDMGKRACGSGSLEEKKAAIPLGEFPEPEDVVKAVLFLLSEDSRMITGAHLPIDGGY
TCH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctagctttaaaaataaacgtgtacttgtcactggtgctgggagaggcattggc
cgagcaattgtgaaagagcttgtttcaaaagaagcttctgttatagctttgagcaaaact
aaagcaaatttagataatctaaaaaaagagttcccttcaattgaaatagttgctgtagat
gttggaaattggaaagaaacagaggctgctgtacagaagctgggagccatagatatgttg
gtgaacaatgcaggaataataactttacaggaagttggaagtattacggaagatgaagtt
gatgaatgcttttcagtaaatgttaaagctgtggcgaatatatctcaaatagttgctgtg
aatatgaagaaggcagggatacgtggtagtattgtcaatctatcaagccaagcctctatg
gtaggcattcctaagcatgctacgtattgtgcatccaaaggggctgtcgatcaattgacg
aaagtgtttgctcttgagctgggcccatctgggattcgagtaaatagtgtaaatccaaca
gttatcctgacagatatgggcaaaagagcttgtggaagtggaagccttgaagagaaaaag
gctgctatacctctcggagaatttccagaaccggaggatgttgttaaagccgtactgttc
ttattgagtgaggattccagaatgataaccggtgctcatctacccatagatggtggatac
acttgtcattag

DBGET integrated database retrieval system