KEGG   Parasteatoda tepidariorum (common house spider): 107451998Help
Entry
107451998         CDS       T06106                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 2-like
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep00230  Purine metabolism
ptep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107451998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptep01001]
    107451998
Enzymes [BR:ptep01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107451998
Protein kinases [BR:ptep01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107451998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 DDE_1 HNOBA DHFR_1
Motif
Other DBs
NCBI-GeneID: 107451998
NCBI-ProteinID: XP_015923749
Position
Unknown
AA seq 1250 aa AA seqDB search
MFLLLIIHWCIVSFVVSSVDEDAFKVGVLMVDGSAWNRFDIQRIGPAIDIAAEKCLRDYN
VVLNLLSGYYPKECSAELAIGKATDLVMAENVSVYIGPACSDDLQVVGRYASYKNIPILT
GLGDVLKERNEFRTLIRMSYDLEDKARAILAFLDHFNWKQFGMIYRQNDVYYTTMSELLY
YMASTNGFIVTCQQSYVRAANKTVLSDLEAIMKIMRDCSRVIVILGGDKDVREMMLIAKQ
LNMTSWGEYAFIYTELFQNEAKGNQSWAKGTEDLDVKLEIKEAYEALFIVSLNQPFSEEY
KKFSENVKKIAKTKYNFTYVENMVNYFTASFHDAVLMLCDVIKETKTMGETPFDGTIIIS
KFKNRTFNGMSGVVTINSEGDRIADYALLDQIDTTTGSFEALEYARKTNVIFVSLPPHTT
NRMQPLDRCVYGPFKTYFEQEVSTFQRSHVGRIITQYDVALLVGKAYSKAASAQNAVQGF
KSSGIWPTNQHIFSDGDFLSVSLTDRAEVIENTNDSPSQIQFTDAGRLSNNSDCSTSTSV
FENVDHNYSQASRISLRRTNGETSYDPSVEDDPSCFTTTSDYSFQPVEEPLTPYVKPLEI
RPLPKPTPNKTSCKRKTQRAEVLTSSPFTNMQMENEEKKKSPIYFRKIRLESKLANMSWR
VRWDEITFLKDMRSSCMMSRLSISSAMSSKMEHGWVCWEPSYPNSIYLDPCSKEAENHRF
ILTGNYKGNTVAVKKVYKQKKIELTRSILIEMKKIREAQHQNVAAFIGACIDSPNVAILT
EYCPKGSLQDVLKNESLDLDWMFRYSLINDVVKGLNYLHSGEMGTHGRLRSSNCLVDSHF
VVKLTDFGLPSFRHAESIAHCEDKNLKKFLWKSPELLRLPVCPPEGTTKGDIYSLGIILQ
EISLREEPFYPFRSSMTVAEILARIRVCESPPFRPVVPKETCSAALIMLMKRCWSEDADD
RPDISQVKAEMRILNRGQNGEVNIMDNLLSRMEQYAHNLESLVEQRTAAFMEEKKKSEEL
LYQVLPRSVAEQLKRGKSVEPEYFENVTVFFSDVVGFTEMCSSSTPIQVVDFLNDLYTCF
DAIINDFEVYKVETIGDAYMVVSGLPDRNGLRHAKEIARMSLALLNAVTSFTIRHRPDDT
VKLRIGIHSGPCCAGVVGQKMPRYCLFGDTINTASRMESTGEPLKIHVSPDTKVALDYFG
NFKLISREEIEVKGKGKMKTYWLLSEIESMRVSASPAVQKREKDTVRRKR
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgctattaataattcactggtgcattgtttcatttgtggtcagttcggttgat
gaggatgcttttaaagtgggtgtcctcatggtggatggatctgcttggaacagattcgac
attcaaagaattggccctgccattgacattgctgctgaaaagtgcttgagggattataat
gttgttttgaatcttctttctggttactatccaaaagaatgttctgcagaattagccatc
ggcaaagctacggacttggtgatggctgaaaatgtgtcagtttatattggaccagcatgt
agcgatgacttacaagtagttggaagatatgcctcctataaaaatattccgattttgact
ggtcttggtgatgttctaaaggaacggaatgaatttaggacgttgataagaatgagttac
gatctggaagacaaagcgcgtgctattctggcgtttttggaccattttaactggaagcag
tttggaatgatttatcgccagaatgatgtatattacacgactatgtcagaattgttatat
tatatggccagcacaaatggttttattgtcacctgtcaacagtcgtatgtccgtgctgcc
aacaaaactgttttatctgatttagaagcaatcatgaaaattatgagggactgctcccga
gttattgtaattcttggaggagacaaagatgtgagagaaatgatgctgattgccaaacaa
ttgaatatgacgtcatggggagaatacgcgttcatttacaccgagttatttcagaatgaa
gccaagggaaatcaatcttgggccaaaggaacagaagatcttgatgtaaagctagaaata
aaagaagcgtatgaagctctgttcatagtgagtcttaaccaacctttttctgaagagtac
aagaaattttcagaaaatgtgaaaaaaatagctaaaacgaagtataattttacatacgtt
gaaaacatggttaactacttcactgcaagttttcacgatgcagttttgatgttatgcgat
gtcataaaggaaacaaaaactatgggtgaaactcctttcgacggaacgatcattatttca
aaatttaagaataggacattcaacggtatgtctggagttgtgaccattaattcagaaggt
gaccggattgcagattatgctcttttggatcagatagatacaacaactggaagttttgag
gcccttgaatatgctagaaaaactaatgtaatttttgtatcgctgcctcctcatacaact
aatcgcatgcaacctctggaccgttgcgtttatggaccgttcaaaacttactttgagcaa
gaagtttccacttttcaaagaagccatgtaggtagaataattactcagtacgacgtagct
ttacttgttggaaaagcatattcaaaagcagctagtgcacaaaatgctgttcaaggattt
aaatcctcaggaatatggcccacgaaccaacacatatttagtgatggtgactttttgtca
gttagtctgacagacagggctgaagttattgaaaacaccaacgatagtccatcgcagatc
caatttactgatgctggtcgtctttctaataattctgattgctctacttccacatctgta
tttgaaaacgtggatcacaattactctcaagcttcaaggatttcgctacgacgcacaaac
ggagaaacttcgtatgatccatctgttgaagatgatccttcatgttttacgactactagt
gactattcatttcaaccagtagaagagccattgacaccttatgtgaagcctttggaaatt
agaccgctgccaaaacctactccgaacaaaactagttgtaaacgtaaaactcaaagagct
gaagtcttaacaagttcaccatttacaaatatgcaaatggaaaatgaagaaaagaagaaa
agtcctatctattttagaaaaattcgcctagaatctaaattggcaaacatgtcttggcgt
gtaaggtgggatgaaataacattcttgaaggacatgcgaagtagctgtatgatgagtcgt
ctatcaatttcaagtgctatgtcgtcaaagatggaacatggatgggtttgctgggaacca
tcttatcctaatagtatatatttggatccatgctcgaaagaagccgaaaatcatcgtttt
attttaacaggtaattacaagggaaatacagttgctgtgaaaaaagtctataaacaaaag
aagattgagctgacaagatcgattctgattgaaatgaaaaagattcgagaagctcaacat
caaaatgtggccgcttttattggagcatgtatcgattcaccaaatgtcgcaattctaaca
gaatactgccctaaaggaagtttacaagatgtattgaagaatgaatcacttgatctagat
tggatgttccgttactcactaattaatgatgttgtaaaaggtttgaattatctgcatagc
ggagaaatgggaactcatggaaggttaagatcatcaaattgtctcgtggatagtcatttt
gtcgtcaagctcactgatttcggactcccctcctttagacacgccgagtctatagctcat
tgtgaagataaaaatttaaaaaaatttctatggaaatcaccggagcttctaaggctacct
gtgtgtccacccgagggaacaaccaaaggtgatatctacagtcttggaattatattgcaa
gagatcagtttgcgtgaagagccattctatcctttccgaagctcgatgaccgtagctgaa
attcttgctaggatccgagtatgtgaaagtccgccttttcgccctgttgtaccaaaagag
acctgctcagctgctttaataatgcttatgaaaagatgttggagcgaagatgcagatgac
agacctgatattagccaagtcaaggctgaaatgcgaattttaaacaggggtcaaaatggt
gaagtgaacatcatggacaatcttttgtcgagaatggaacaatatgctcacaatttagag
tcactcgttgaacagaggacagcagcattcatggaggaaaagaagaaatccgaagaacta
ctttaccaggttttgccgagatcagttgcagagcagttgaaacgaggcaaatctgttgag
ccagaatatttcgaaaatgtgacagttttcttcagcgatgtggtcggatttacagaaatg
tgttcatcaagcactcccattcaggttgtagattttttgaatgacttatacacatgcttt
gatgccattatcaacgatttcgaagtatataaagtggagacaattggagatgcttacatg
gttgtctcaggacttccagatagaaatggtctgagacacgccaaagaaattgcacgaatg
tcattggctctcttgaacgctgtcacttctttcacaataaggcatagaccagacgataca
gtgaaacttagaatcggtatacattcgggcccatgttgcgcaggcgtggtgggtcagaaa
atgccgaggtattgtttgtttggtgatactatcaacactgcctctaggatggagtcaacc
ggagagccactaaaaatacatgtgagtccagatacaaaggtggctttagattattttgga
aatttcaagttgatttcgagagaggaaatcgaagttaagggaaaaggtaaaatgaaaaca
tattggttgctctcagaaatagaaagtatgagagtttctgcatctccagctgttcagaaa
agagaaaaagataccgtaagaagaaaacgataa

DBGET integrated database retrieval system