KEGG   Parasteatoda tepidariorum (common house spider): 107452983Help
Entry
107452983         CDS       T06106                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107452983
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptep03041]
    107452983
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107452983
Spliceosome [BR:ptep03041]
 Complex C
  Other components
   Step II factors
    107452983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 OB_NTP_bind DEAD RRM_1 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 AAA_22 zf-C3HC4 zf-RING_5 Helicase_RecD AAA_30
Motif
Other DBs
NCBI-GeneID: 107452983
NCBI-ProteinID: XP_021000926
Position
Unknown
AA seq 1791 aa AA seqDB search
MYLCEIAIKQNLKEMEALPDRDELNFPVSLSDAVKTEDEASSDHIHLAASSFLPEPNKTY
AACEKDTDTEKFRQGLKYHDMESYVSQRDHKIGVGLFNTDEIEDLPPRHKKKVASAYEKL
RTYELYLLKKSKANDPNILPPPDLFSHETDHDNVCLLTKSTENLNTESDLVFDCNAPPGK
PHNKLRQYDKGNKSYIQESLNETLVNLDSNNVMNKEFSSNSSNTSVSTLSNKNFNSMYGK
KEQFSMSHTPQKKRYIRSQLANCSQYGGEIDRINSREEKRIDASKMPQVKDIGFFLHITV
SENSKKLDVWKLFFSNHLRSINFDVFRCCDFAESFILQFDTNEDASKAHWQLYKLKHRNK
DISKLHINSLSSVKKHLMRPCLCENVLIEQCDKYFDEFACKYISTHKAKMDTIIDELNSL
KFQKSGNTPNEAYLSLKDAFDTLRAMETVFKNYVRKAKDLASQCSVSESGSTELKKLKLN
FSRECNSFERGLPIYSQKDIILNAIKNYPVSVIVAETGSGKSTQLTQYLLQTSFADNGSI
ICTQPRKIAAVSIAKFVCTQVGSSVGKEVGYDVGIEKKFDESTKIIYMTDYALLRKCLRN
RNLKRVSCVIIDEAHERTLYTDLLLGLLKQCLGYRQDLRIIITSATINPSVFVKYLNLPD
GAVINVPGRAYPVEIIWSEHNVNKENMYIKECVKTAVRVHQRESKGDILVFLSSPAETDE
AILLFEEMCPDKNMLELMSLHGKSDIKDQMLVFETSTNDRRRIIFATNAAETSLTIPGIK
YVIDSGMAKEMIFYPEKNKSCLMPTLINKSSAEQRKGRAGRTQPGVCYRLYSKKDFENMP
ERALPELLKTDLLNALLKVYEFGIKPSSFDFVESPSKEAITRSINSLEVLELIEKNELTE
LGKQVVQLSIEPRLAKFILLGVKFGMGHEAAIIAALVSEAGRIFLRFNDNKETSDRKKRN
FCQESGDLCTFLEIYKTWLEVSQTDRFNWCVSNCVSFKALSSARKTVKEILFTLRQDLGI
KVSSQYNNLSFKNNFETILFSSFIENLCIYSGHASFGYRSPNINESLFIHPSSSLKYLRT
VPPKFLVYTVFMETSKNYILDVTPLKEETVNKAFLKGNYTVENLKQLQIPPITLGPFGEK
ILSHCILGEGGSVINNIEYLLKKLTEIRNLRIDICRDKGLIIVHVVEKFHQIVSNFIQDI
VNEEREKMVQETDVIKMDEGFYYYCLSTGGLIHDIVMPGEFREITIEPIDQRSISELESI
LRQFGPIQTLEKKNLKYKHSINVTYLTVSDAQNALKCLNKKNVKGVRVQNIVPKVNKSSK
PLYKLKFKWPRLLAKGTGSIFFSSAEDRVLVSGKLSTKSLYVDSNHINVTPSQNDLCLNL
KNIPQSANERLLQEKISEALPDFLRELVKGVEIYRRDSLAVSENDIVKIKEQLHQSLSRF
TPPNKVAVNVVYPTSTSKNYEAFAYFECYEDGRTAFQQLKGRLKLNNIQVDILEILQSQV
ECKEHVYNFLRRDIQSVITKQEGKVNVTKLSDSLEDKVAIEFSCGSIEKLKTINNKILSL
VCARKVECSRNKKYFYLFTDSGKKKLDEIQARTKTLIECDSDSKIVFIYGQSEMRYKAEA
EIHSFIETAKLLKTKIFDLKSSQIPPGFLKKLYSRYGFDLYGLITKFDLKTANIDMKFGN
LTVEGEFRNINKVEEHLEDICAKLYTSNPKKADDDVGCGMCAICLDPVNIDYYRLENCGH
SFCKSCLILQLKSKIIPVTCAQEVYSVSDFSQICKIHVISKFRQIVFLRLV
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atgtatctttgtgaaatcgctataaagcagaatcttaaagaaatggaagctctaccggat
agagatgagttaaattttcctgtttcattaagtgatgctgttaaaacagaggatgaagcc
agtagtgatcatatccatcttgcagcatcatcattcttgccagaaccaaataaaacctat
gcagcctgtgaaaaagacactgatactgagaaatttcgccaaggtcttaaatatcatgat
atggaaagctatgtgtcacaaagagaccacaaaataggtgttggtctttttaataccgat
gaaattgaagatttgccaccaagacacaaaaagaaggttgcttctgcttatgagaaatta
agaacatatgaattatatttactaaagaagtctaaggctaatgatcctaatatactacct
cccccagatttatttagtcatgagactgatcatgataatgtttgtttactaactaaatca
acagaaaatttaaatactgagtctgatttagtgtttgattgtaatgctcctccaggtaaa
ccccataataaactaagacaatatgataaaggcaataaatcttacattcaagaaagctta
aatgaaaccctagtgaacttagactcaaataatgttatgaataaagaattttcaagcaat
tcatcaaatacttctgtatctacattaagcaacaaaaattttaatagtatgtatggcaaa
aaagagcaattttcaatgagccatactccacaaaagaagagatatatccgctcacaactt
gctaactgttctcagtatggcggggaaattgatagaattaattctagagaagaaaaaaga
attgatgcctcaaaaatgccacaagttaaagatataggatttttcttacatatcacagta
tctgagaattctaaaaaattagatgtgtggaagttatttttcagtaatcatttaaggtcc
ataaactttgatgtctttaggtgttgtgattttgctgaatcttttattcttcagtttgat
actaatgaagatgcttcaaaagctcattggcaactctataaattaaaacataggaacaag
gatatttctaaacttcatattaactcactgagttcagtgaagaaacatctgatgagacct
tgtttgtgtgagaatgtcttaattgagcaatgtgataagtattttgatgaattcgcctgt
aaatatatttctactcataaagctaaaatggatacaattatagatgaattaaattcgtta
aaatttcagaagtctggtaacacccccaacgaggcatatttaagtttaaaagatgctttt
gatactctcagagctatggagacagtttttaaaaattatgttagaaaagctaaagacttg
gcaagtcagtgttctgtgtcagagtcaggatctactgaattgaaaaaacttaagttaaat
tttagtagagagtgtaattcttttgaaagaggcttaccaatatattctcaaaaagacatc
attctcaatgccattaaaaactatcctgtatctgttattgttgccgaaactgggtcagga
aaaagcactcagttgactcaatacctcctgcaaacttcatttgccgataatggttctatt
atttgcactcaaccacgaaaaatagctgcagtcagcattgctaaatttgtatgtactcag
gtaggatcttcagtaggaaaagaagtgggatatgatgttggaattgaaaagaagtttgac
gaatcaactaagattatttatatgactgattacgctttattgagaaagtgtttacgaaat
agaaatctgaaaagagtatcgtgtgtcattatcgatgaagcccatgagcgaactctttat
acggatttattgcttggtttgttgaagcagtgtttagggtataggcaagatttgagaatc
attataacatcagcgactataaatccatccgtatttgttaagtatttaaatcttccagat
ggtgcagttataaatgtgcctggacgtgcttaccctgttgaaataatttggtcagaacat
aatgtaaataaagaaaatatgtatataaaggaatgtgtcaaaacagctgttagggtgcac
caaagagaatcgaaaggggatattcttgtatttttgtcatcaccagcagaaactgatgaa
gctattttattgtttgaagaaatgtgtcctgataaaaatatgctagagctaatgagttta
catggcaagtctgatataaaagatcaaatgcttgtttttgaaactagtactaatgataga
cgtagaataatttttgctactaacgctgctgagacttcattaactattcctggaattaaa
tacgtaattgatagtggaatggctaaagagatgatcttttacccagaaaaaaataaaagt
tgcttgatgccaactttaattaataaaagctctgctgaacagcgaaaaggtagagctgga
cgcactcaacccggagtctgttatcgtttatactctaaaaaagattttgaaaatatgcct
gaacgagctctcccagagttgctgaaaacagatttacttaatgcattattgaaagtttat
gaatttggtattaaacccagtagtttcgattttgtggaatctccatcaaaagaagccata
acaagatcaatcaattcattagaggttttggaattgattgaaaagaatgaattaacagaa
ttaggaaaacaagttgttcagctttctatagaacctagacttgctaaatttattctatta
ggtgtaaaatttggcatgggtcatgaggctgctataattgcggctctagtttctgaagca
ggaaggatatttttgagatttaatgacaacaaagaaacatctgatcgaaagaaaagaaac
ttttgccaagaaagtggtgatctatgtacttttttagaaatttataaaacatggctggaa
gtgtcccaaacagatcgatttaactggtgtgtttcaaactgtgtaagcttcaaagcatta
agctctgctcgcaagacggtcaaagaaattttattcactctgcgacaagacctcggtatt
aaagtatccagtcaatataataacttatcttttaaaaataattttgaaacaattcttttt
agcagttttattgaaaatttatgtatatattcagggcatgcttcctttgggtatcggtct
cccaacatcaatgaatcgttatttattcatccatcctcgtcattgaaatacctcagaaca
gtacctcctaaattccttgtatatacagtttttatggaaacttcaaagaattatatcctt
gatgtaacacccttaaaagaagaaacagttaacaaggcatttttgaaaggtaattatact
gttgaaaatctaaaacagctacaaattccacccataactttgggaccttttggagaaaaa
attctgtctcattgcattttaggtgaaggaggctctgtaattaataatattgagtatctg
ttaaaaaaattaactgaaattagaaatcttagaattgacatttgtagagacaaaggattg
attattgttcacgttgtggaaaaatttcatcaaatagtgtctaattttattcaagatata
gtgaatgaggaaagggagaaaatggtacaagagactgatgtcatcaagatggatgaagga
ttttattactattgtttatcgacaggtggattgattcatgatatagtaatgcctggagaa
tttcgtgagatcacgattgagcccatcgaccaaagatcgataagtgagttagaatctatt
ttgaggcaatttggtccaatacagactcttgagaaaaaaaacttaaaatataaacatagt
attaatgtgacttatttaactgtttctgatgcccaaaatgctctcaaatgtttaaataaa
aaaaatgtcaaaggtgttagggttcaaaatattgttccaaaagtcaataaatcttctaag
cctttatataaactcaagtttaaatggcctcgtttgcttgcgaaaggtactggttccata
tttttctcctctgctgaggatcgtgtgttggtttctggaaaattatctaccaaatctttg
tatgttgatagcaatcatatcaatgtgacaccctctcaaaatgatctctgtcttaacttg
aaaaatatacctcaatcagcaaacgaaagattgcttcaagaaaaaatatctgaagcactt
cccgatttcttaagggaacttgtaaaaggtgttgaaatatatcgacgggactctttagct
gtttcagaaaatgatattgttaaaattaaagagcagctgcatcagagcctgagtaggttc
actcctccgaacaaagttgctgttaacgttgtgtacccaacatctacttccaaaaattat
gaagcatttgcttattttgagtgctatgaggatggaagaactgcatttcagcaattgaaa
ggtaggctcaagcttaacaacattcaagttgatattttggagatattgcagtcacaggtt
gaatgcaaagagcatgtatataattttctgcggagggatatacaaagtgttatcacaaaa
caggaaggaaaggttaatgtaacaaagttgtctgactctcttgaagataaagttgctatt
gaattttcttgcggaagtattgaaaaacttaaaaccataaataacaagattttaagtctg
gtgtgtgcccgtaaagtagaatgcagccgtaacaaaaaatatttttatctcttcactgat
agtggtaagaaaaaattagatgaaatccaagctcggacaaaaactctcatcgaatgtgat
tctgatagcaaaattgtttttatatatggtcaaagtgaaatgcgttataaggctgaagca
gaaattcattcgttcattgaaacagcaaagttactcaagacaaagatctttgatctgaaa
agctcgcagataccgccaggctttttgaaaaaactttattctagatatggatttgatttg
tatggcctaatcacgaaatttgatttaaaaacagcgaacattgatatgaaatttggtaat
cttacagttgaaggtgaatttcgcaacattaataaagttgaagagcatttagaagatatt
tgtgccaagctttatacaagtaatccaaagaaagcagatgatgatgttggatgtggtatg
tgtgctatatgtctagatcctgtaaacattgattattatagacttgaaaactgtggtcat
tccttctgcaaatcctgtctaattttacaactaaaaagcaagattattcctgttacttgt
gctcaagaggtatattctgtttctgatttttcacaaatttgtaagattcatgtaatttca
aaattcagacaaattgtttttcttagactagtatga

DBGET integrated database retrieval system