KEGG   Parasteatoda tepidariorum (common house spider): 107453758Help
Entry
107453758         CDS       T06106                                 

Definition
(RefSeq) ATP-dependent RNA helicase DDX18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptep03041]
    107453758
   03009 Ribosome biogenesis [BR:ptep03009]
    107453758
Enzymes [BR:ptep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107453758
Spliceosome [BR:ptep03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    107453758
Ribosome biogenesis [BR:ptep03009]
 Eukaryotic type
  90S particles
   Helicases
    107453758
  Pre-60S particles
    107453758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII AAA_30 AAA_19 SecA_DEAD DUF2075 AAA_22
Motif
Other DBs
NCBI-GeneID: 107453758
NCBI-ProteinID: XP_015926183
UniProt: A0A2L2Y3R9
Position
Unknown
AA seq 453 aa AA seqDB search
MENLSNISFDTLQQNVSENTLKAVTDMGFEQMTEIQARTIPQLLEGSDAVVSAKTGSGKT
LAFLIPAIELLKKLDFTESQGTGILIISPTRELSMQTYGVLQELVKYHSFTHGLIMGGTS
RQSEAQKLSKGMNILVATPGRLLDHLKNTKQFLYRNLKCLIIDEADRILDIGFEEDMRRI
IQTLPKKRQTLLFSATLTKKTNDLINVALKKDPLYIGVDEVEEKATVEGLKQGYVVCSSA
ERFLLLFTFLKKNRNKKMMVFFSSCLSVKFHNELFNYIDLPTVCIHGKQKQSKRTSTFFN
FCKAKSGILLCTDVAARGLDIPEVDWIVQYDPPSDPKEYIHRVGRTARGENKNGHAILIL
RPEELGFLKYLKHARVPIQEYDFSKSKIANVQNQLEKLITKNYFLQMAARDAYKSYVLAY
KSHHMKTVYDVTNLDLAAVAKSFGLTVPPFVKT
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagaatctgagtaacattagttttgatactcttcaacaaaatgtgtctgaaaatacc
cttaaagcagtcactgacatgggatttgaacagatgactgagattcaagcgagaacaatt
cctcaattacttgagggcagtgatgctgtagtgtctgcaaaaacaggcagtggcaaaact
ctagcatttcttattcctgcaattgaacttttaaagaagctagattttactgaaagccaa
ggaactggtattttaattatatctcctacacgagaactttcaatgcaaacatatggagtc
cttcaagaattggtaaaatatcactctttcactcatggacttatcatgggtggaacaagt
aggcaatcagaggctcaaaaattgtccaaaggaatgaatattttagttgctacacctggt
agacttcttgatcatttaaaaaataccaaacaatttttgtacagaaatttaaaatgtctg
ataattgatgaagctgacagaatcttggacattggatttgaagaggatatgcgtagaata
attcaaactcttccaaaaaagagacaaacactcctttttagtgctaccctcacgaagaaa
actaatgatttgattaatgtagctttgaaaaaagatcctctttatattggggttgatgaa
gtagaagagaaagcaactgttgaaggcttaaaacagggctatgtagtttgttcatcagct
gaaaggtttcttctactttttacatttttaaagaagaatagaaataagaagatgatggtg
ttcttcagctcttgtttatctgtcaaattccacaatgaactgttcaattacatagattta
cctacagtttgcattcacggaaaacagaagcaaagcaaaagaacatcaactttcttcaac
ttttgtaaagcaaaatctggtattctgctatgtaccgatgttgcggccaggggcttagac
atacctgaagttgactggattgtgcaatatgatccaccatcagatccaaaggaatatatt
cacagagttggtagaactgctagaggtgaaaataaaaacggacacgctatactcatactt
agaccagaggaattaggttttctgaagtatttgaaacatgcaagagttccaattcaagag
tatgatttctcaaaatcaaaaattgcaaatgttcagaatcagctggagaaacttattaca
aagaattactttcttcaaatggctgcaagagatgcttacaaaagctatgttttagcttat
aaatctcatcatatgaaaactgtttatgatgtgacaaatctagatctagctgctgttgcg
aaatcatttggactcactgtacctccttttgttaaaacttaa

DBGET integrated database retrieval system