KEGG   Parasteatoda tepidariorum (common house spider): 107456236Help
Entry
107456236         CDS       T06106                                 

Definition
(RefSeq) probable pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep00790  Folate biosynthesis
ptep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107456236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptep04147]
    107456236
Enzymes [BR:ptep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     107456236
Exosome [BR:ptep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107456236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 107456236
NCBI-ProteinID: XP_015929543
Position
Unknown
AA seq 132 aa AA seqDB search
MINILIRSKVKLNIPAFVAICSRTKMSSAQKMKLSEEDRTNKLSPLLNAGWSMLDKRDAI
HKEFVFKNFNEAFGFMTRIAMQAEKMDHHPEWFNVYNKVQITLSSHDVSGLSDRDVRLAN
FIEKAAEFVKVK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgataaatatcttgatacgaagcaaagttaagttgaacataccggcatttgtagcaatc
tgttctcgaacaaaaatgtcatcggctcagaaaatgaagctatctgaagaagacaggaca
aacaagttgtcacctttactaaacgctggatggtctatgttagacaaaagagatgccatt
cacaaagaatttgtgtttaaaaacttcaacgaggcgtttggatttatgactcgcattgcg
atgcaagcagagaagatggaccaccatcctgagtggtttaacgtgtacaataaagtccag
ataacattaagtagccatgacgtaagtggattatcggatagggatgtccgactagcgaac
tttattgagaaagccgctgaattcgtcaaagtcaaatga

DBGET integrated database retrieval system