KEGG   Parasteatoda tepidariorum (common house spider): 107457349Help
Entry
107457349         CDS       T06106                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep00450  Selenocompound metabolism
ptep00970  Aminoacyl-tRNA biosynthesis
ptep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107457349
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107457349
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptep01007]
    107457349
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptep03016]
    107457349
Enzymes [BR:ptep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107457349
Amino acid related enzymes [BR:ptep01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107457349
Transfer RNA biogenesis [BR:ptep03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107457349
 Prokaryotic type
   Other AARSs
    107457349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 107457349
NCBI-ProteinID: XP_021001206
Position
Unknown
AA seq 544 aa AA seqDB search
MSISQLTRVLTRSHHYFVSTPIFYVNGAPHIGHMQSCLYADALARCRRLLGGDVLFSTGT
DEHGLKVQQAAETLKVPVSEHCMQMSSKFVEVFKAGDVSYTQFIRTTDDKHKFMVQKFWK
MLDANGCIRKDKYEGWYSVIDEAFIPSSQVKEIKEGSEFKMVSSETGSPVEKMSEENYVF
CLSKYQNDILYWLSKDVIKPSIFQDDVKRFVAEGLIDLSVSRPCSRLFWGIPVPDDETQI
IYVWLDALVNYLTVSSNDSTSSFWPPDCHVIGKDILKFHAIYWPAFLIAAGFEPPKHIFC
HSHWTVDHEKMSKSKGNVIDPLTLMKKYSPDGFRYFMLRASVPHSDTNYSEVKLHRMVNA
ELADNLGNLLSRCCATAINPDQQFTHFYHDTLKSLSEPDVHALIKKASELPGQVQEHFLG
GYFYKGLDCIIECLRDTNAFMQFNKPWELAKQNDDVSKKRLSTILHVVLETLRICGILLQ
PIIPTLSSKLLDKLQISNSERTWKNICCFPSYYNVPNSFEGRPLGHIQLPLYGRKIASYK
TSGT
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttctcagttaactagagtcttaacaagatcacatcattattttgtttctact
ccaatattttatgtaaatggtgctccacatattggacatatgcaatcgtgtttatacgct
gatgcactcgcaagatgtcgccggttactgggaggtgatgtcttattttccacaggtact
gatgagcatggattaaaggtacaacaagcagctgaaactcttaaagtacctgtttcagaa
cattgcatgcaaatgtcttccaagtttgtggaagtatttaaagctggtgatgtatcatat
actcaatttattcgaaccactgatgataaacataaatttatggttcaaaaattctggaaa
atgctggatgccaacggttgcatcagaaaagataaatatgagggttggtacagtgtaatt
gatgaagctttcattccatcatctcaagttaaagaaatcaaagaagggtcagaattcaaa
atggtatcaagtgaaacaggatcaccagtagagaaaatgtcagaagaaaattatgtattt
tgcctttctaaatatcaaaatgacattttatattggctttccaaagatgtgataaagcct
tctatatttcaagatgatgtaaaaagatttgttgcagaaggcctgattgatttgtctgta
tccagaccttgttctcgtttgttttggggcataccagttcctgatgatgaaacacaaatc
atttatgtttggcttgatgcgttagttaattatttaactgtgagttcaaatgattccact
agttcattctggccacctgattgccatgttattggaaaagatatactaaaatttcatgca
atatattggcctgcttttcttattgctgctggttttgaacctccgaagcacattttttgt
cattctcattggactgtagatcatgaaaagatgtctaaaagtaaaggaaatgttattgat
cctttaacgctgatgaaaaaatatagtcctgatggatttcggtatttcatgctaagagca
tcagttcctcactctgacacaaattatagtgaggtgaagctacacagaatggtaaacgcg
gagctagctgataatttagggaatttgctcagccgatgttgtgccactgccattaatcct
gatcaacaatttacacacttttatcatgacactcttaagagtttgtcagaaccagatgtg
catgcccttattaaaaaagcttctgaactaccaggtcaagtccaggagcatttcttgggt
ggatacttttataaaggcttggattgcatcattgagtgcctgagagacacaaatgcattt
atgcagtttaacaaaccttgggaactagctaagcaaaatgatgatgtgagcaagaagaga
ctatcaactattttgcatgttgtcttagaaacattacgtatttgtggtattttacttcag
cccattataccaacgctatcatctaaacttttagataaactacaaatctctaatagcgaa
agaacttggaagaatatttgttgttttccatcatattataatgttccgaattctttcgag
ggaagaccacttggacatatccagctccctctatatggtcgaaaaattgcatcatacaaa
acttctggaacatga

DBGET integrated database retrieval system