KEGG   Parasteatoda tepidariorum (common house spider): 110282151Help
Entry
110282151         CDS       T06106                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 2-like
Organism
ptep  Parasteatoda tepidariorum (common house spider)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase
Motif
Other DBs
NCBI-GeneID: 110282151
NCBI-ProteinID: XP_021000618
Position
Unknown
AA seq 125 aa AA seqDB search
MKERGQGGSIVNVSSIASFRTCPALGVYGSSKGAVDQLTRCMATEYGPHNIRVNSVNPTG
VRTRMAAEYFEPDNELGKMFKERTPLKRLGEVDDVAYPILFLLSEYASLISGITLPIDGG
IANVF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaagaggacaaggaggctcgattgttaatgtttcaagtattgcctctttccga
acatgtccggctcttggcgtatacggttcaagtaaaggggcagtggatcagctgacaaga
tgcatggcaactgaatacggacctcataatataagagtgaactctgttaatcctaccgga
gtacgtactcgtatggcagcagagtattttgaacctgataatgaattagggaaaatgttt
aaagaacgaacacctttaaaaagattaggagaagtggacgatgttgcatacccgatatta
tttttgctgagtgaatatgcatccctgattagtggaataacattgcccattgatggagga
attgcaaatgttttttag

DBGET integrated database retrieval system