KEGG   Paraburkholderia terrae: C2L65_00525Help
Entry
C2L65_00525       CDS       T05318                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
pter  Paraburkholderia terrae
Pathway
pter02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pter00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C2L65_00525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pter02000]
    C2L65_00525
Enzymes [BR:pter01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     C2L65_00525
Transporters [BR:pter02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    C2L65_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_30 AAA_29 RsgA_GTPase Zeta_toxin AAA_16 MMR_HSR1 Ploopntkinase3 AAA_23 AAA_15
Motif
Other DBs
NCBI-ProteinID: AUT58241
UniProt: A0A2I8EG00
Position
1:complement(115904..117550)
Genome map
AA seq 548 aa AA seqDB search
MTQSHAPSDAAPGAHPPPPSSRATLLDMQGIDISFGGVPALRGANLSVAAGEVHALIGQN
GAGKSTMIKILTGAYRRSGGSVRFEGREIDFRTPKEAREAGISTIYQEINLVPFRSVAEN
IFLGREPRRFGLIDWREVQRRASALLESFGLQIDVKKPAGSYSTAIQQMVALARAVSSDA
KMVIMDESTSSLDEREVELLFTVVRKLRDDGRAVIFVSHRLDELYALCDRVTVMRDGQTV
AQSAMKDIDKRQLVTTMLGRTLAAVVQDDSTAREANLARRGDKAISARNLSAHPKVSDVS
LDVHAGEAVGLAGLLGSGRTETMRLLFGADPAERGTLSINGKDVALKSPQDAIARGLAYL
TEDRKAEGIVPDLSVRDNLTLVCLRTLSKHGIVDVKQQQAIVDRFIASLGIKLRSPDQPI
RELSGGNQQKVLLARWLAAQPSLLLLDEPTRGIDVGAKADVAKIVRELRDEGMAVLLSAS
ELEELTAVADRAVVIRDGRTVAELDGAQMSESAIMDAIAYGSAGTSQLVEAAQSAHIDDA
LEGDRHGS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaatcccacgcgccttccgacgcggcccccggcgctcatccgccgccgccgtcc
tcacgcgcgaccctgctcgacatgcagggcatcgacatttcgttcggcggcgtgcccgcg
ttgcgcggcgcgaatctcagcgtcgccgcaggcgaggtgcatgcgttgatcggtcagaac
ggcgcgggcaaatcgacgatgatcaagatcctcacgggcgcctaccggcgctcgggtggc
agcgtgcgcttcgaaggtcgcgagatcgatttccgcacgccgaaggaagcgcgcgaagca
ggcatcagcacgatctaccaggagatcaacctggtgccgttccgctcggtggctgagaac
attttcctgggccgcgagccgcgccgcttcggtctgatcgactggcgcgaagtgcagcgg
cgcgcgtctgcgctgctcgaatcgttcggtttgcagatcgacgtgaagaagcccgcgggc
agctattcgacggcgattcagcagatggttgcgctcgcgcgcgccgtgtcgtcggacgcg
aagatggtcatcatggacgaatcgacttcgtcactcgacgaacgcgaagtcgaactgctg
ttcaccgtcgtgcgcaagctgcgagacgacgggcgcgcggtgatcttcgtgtcgcatcgg
ctcgacgaactgtatgcgctgtgcgaccgcgtgacggtgatgcgcgacggccagaccgtc
gcgcaaagcgcaatgaaagatatcgacaagcgccagctcgtcacgactatgctcggccgc
acgctcgccgccgtcgtgcaggacgacagcaccgcgcgcgaggcgaatctcgcgcgacgc
ggcgacaaggcgatctcggcgcgcaatctgtccgcgcatccaaaggtgagcgacgtgtcg
ctcgatgtgcatgcgggcgaagccgtcggcctcgcgggcctgctcggctcgggccgtacg
gaaacgatgcgcctgctgttcggcgccgaccccgccgagcgcggcacgctgtcgatcaac
ggcaaggacgtcgcgctgaagtcgccgcaggatgcgatcgcgcgcggcctcgcgtatctc
acggaagaccgcaaggccgaaggcatcgtgccggacctgtcggtgcgcgacaacctcacg
ctcgtctgtctgcgcacgctgtcgaagcacggcatcgtcgatgtgaagcagcagcaggcg
atcgtcgatcgctttattgcgtcgctcggcatcaagctgcgctcgcccgatcagccgatc
cgcgaactgtcgggcggcaatcagcagaaggtgctgctcgcgcgctggctcgccgcgcag
ccgtcgctgctattgctcgacgagccgacacgcggcatcgacgtcggcgcaaaggcggat
gtcgcgaagatcgtgcgcgaactgcgcgacgaaggcatggcggtgctgttgtccgcttcc
gaactcgaagaactgacggccgtggccgatcgcgccgtcgtgattcgcgacggacgtacg
gtcgccgaactggatggcgcgcaaatgagcgaatccgcgatcatggacgcgattgcctac
ggcagcgcgggcacctcgcaactggtggaagcagcgcagtccgcgcatatcgacgatgca
ctggagggcgaccgtcatggctcatga

DBGET integrated database retrieval system