KEGG   Paraburkholderia terrae: C2L65_05840Help
Entry
C2L65_05840       CDS       T05318                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pter  Paraburkholderia terrae
Pathway
pter00230  Purine metabolism
pter00240  Pyrimidine metabolism
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01130  Biosynthesis of antibiotics
Module
pter_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pter_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pter_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2L65_05840
   00240 Pyrimidine metabolism
    C2L65_05840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pter04131]
    C2L65_05840
Enzymes [BR:pter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     C2L65_05840
Membrane trafficking [BR:pter04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    C2L65_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AUT59175
UniProt: A0A2I8EHV7
Position
1:1306709..1307134
Genome map
AA seq 141 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAERPFF
KDLVEFMISGPVQVQVLEGEGAILKNRDLMGATDPKKADKGTIRADFADSIDANAVHGSD
AVETARGEIAFFFPEVNVYSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcaccctgtcgattatcaagccggacgcagtggccaagaacgtgatc
ggccagatctacagccgcttcgaaaacgctggcctgaagatcgtggcatcgcgcatggtt
cacctgtcgcgcgctgacgcagagaagttctacgctgtgcatgcagaacgcccgttcttc
aaggatctggttgaattcatgatctccggcccggtgcaggttcaagtcctggaaggcgaa
ggcgccatcctgaagaaccgcgacctgatgggtgcaacggatccgaagaaggccgacaag
ggcacgatccgtgctgacttcgccgacagcatcgacgcgaacgcagtccatggctcggac
gcagtggaaacggcacgcggcgaaatcgcgttcttcttcccggaagtcaacgtctactcg
cgctaa

DBGET integrated database retrieval system