KEGG   Paraburkholderia terrae: C2L65_11525Help
Entry
C2L65_11525       CDS       T05318                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pter  Paraburkholderia terrae
Pathway
pter00860  Porphyrin and chlorophyll metabolism
pter01100  Metabolic pathways
Module
pter_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C2L65_11525 (cobC)
Enzymes [BR:pter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     C2L65_11525 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AUT60161
UniProt: A0A2I8ELG3
Position
1:complement(2613263..2613853)
Genome map
AA seq 196 aa AA seqDB search
MDIVLIRHPAVSVQEGVCYGQSDVALADPPEASAAAVAVRLATLQVPAPRVLLSSPLTRC
ATVATALAANFGCAYSVDDSLKEMDFGTWELQRWDDIDRALLDAWAQDFEGARAHGGESV
EQFVSRVRAWFDVFQQTRELTPAYVVTHAGVMRVIAATVLGLPVERCLTWSIDMAGCVWL
RRDDTNLQWSIVRWNA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgttctgatccgacacccggctgtttctgtacaagagggcgtgtgctatggc
cagagcgacgtggcgctcgccgatccgccggaagcttcggcggctgccgtcgccgtgcgt
cttgccaccttgcaggtgcccgcgccccgcgtgctgctgtcgagtccgctcacgcgctgc
gcaacggtcgcgactgccctcgccgcgaactttggttgcgcgtatagcgtcgacgacagt
ctgaaggaaatggacttcggcacgtgggagttgcaacgttgggacgatatcgatcgcgcg
ttgctcgatgcatgggcacaggacttcgaaggcgcgcgcgcgcatggcggcgaaagcgtc
gagcagttcgtgagccgcgtgcgcgcgtggttcgacgtattccagcagacccgcgaattg
acgccggcgtatgtcgtcacgcatgcgggcgtgatgcgcgtgatcgcggcgactgtgctc
gggttgcccgtcgaacgctgcctgacatggtcgatcgatatggcgggttgcgtctggttg
cgccgcgacgatacgaacctgcaatggtcgatcgtgcgctggaacgcgtga

DBGET integrated database retrieval system