KEGG   Paraburkholderia terrae: C2L65_36880Help
Entry
C2L65_36880       CDS       T05318                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pter  Paraburkholderia terrae
Brite
KEGG Orthology (KO) [BR:pter00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2L65_36880 (pdxA)
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     C2L65_36880 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     C2L65_36880 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AUT65144
UniProt: A0A2I8F296
Position
3:complement(1606128..1607126)
Genome map
AA seq 332 aa AA seqDB search
MSNYLPVIGITMGDAAGVGAEVVVKSLAHASVYAQCRPLVIGDARRLERANQIVGGTMKI
RRIEDASDARYEQGTIDCIDLGLIPDDLPFGQLSALAGDAAYQYIKRAVELAQAGKIDAI
CTAPLNKEALHAGGHKYPGHTEMLAHLTGVDEVSMMLVAPQLRVIHVTTHIGIIDAIRKI
EPGLVQRTIERGNATLVKAGIEHPRIGVCGINPHAGENGLFGYGEEEEKIIPAVKLLQER
GLDVTGPLPADTLFFRAGRGDFDLVVAMYHDQGHGPVKVLGLEAGVNVTVGLEVIRTSVD
HGTAFDIAGKGVVDEGSMLEALRQGAELATRR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactaccttcccgtaatcggcatcacgatgggcgatgcagcaggcgtcggcgca
gaagtcgtcgtcaagagcctcgcacacgcgtcggtctacgcgcaatgccgtccgctcgtg
attggcgatgcgaggcgcctcgaacgcgcgaaccagatcgtcggcgggacgatgaagatt
cgccgcatcgaagatgcatccgatgcgcgctacgaacaaggcacaatcgactgcatcgac
ctcggcctgattcccgacgacctgccgttcggccagttgtcggcactggcgggcgacgcc
gcgtatcaatacatcaagcgcgccgtcgaactcgcgcaggcgggcaagatcgacgcgatc
tgcacggcgccgctcaacaaggaagcattgcatgcgggcggccacaagtacccgggccac
acggaaatgctcgcgcatctgacgggcgtcgacgaagtgtcgatgatgctggtcgcgccg
caactgcgcgtgattcacgtgacgacgcacatcggcatcatcgacgcgatccgcaagatc
gagccgggcctcgtgcagcggaccatcgaacgcggcaacgcgacgctcgtgaaggcgggc
atcgaacatccgcgcatcggcgtgtgcggcatcaatccgcacgcgggcgaaaacggcctg
ttcggctatggcgaagaagaggagaagatcatccccgccgtgaagctgctgcaggaacgc
ggcctcgacgtcacgggtccgctgcccgccgacacgctgtttttccgcgcaggccgaggc
gactttgatctggtggtcgcgatgtatcacgaccagggccacggcccggtgaaggtgctc
ggcctcgaagcgggcgtgaacgtgacggtggggctggaagtgatccgcacgtcggtcgat
cacggcaccgcgttcgatatcgcgggcaagggtgtcgtcgacgaaggcagcatgctcgaa
gcgttgcgccagggcgcggaactggcgacgcgccgctga

DBGET integrated database retrieval system