KEGG   Paraburkholderia terrae: C2L65_40340Help
Entry
C2L65_40340       CDS       T05318                                 

Definition
(GenBank) L-fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
pter  Paraburkholderia terrae
Pathway
pter00051  Fructose and mannose metabolism
pter01100  Metabolic pathways
pter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C2L65_40340
Enzymes [BR:pter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     C2L65_40340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AUT65747
UniProt: A0A2I8F1H8
Position
3:complement(2368084..2369382)
Genome map
AA seq 432 aa AA seqDB search
MTTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSATYVTLETDSPHKLTGHGLTFTIGRGN
EICVTAVNALTPLIVGRKLEDIAENMGAFWRAFTSDSQLRWIGPDKGAIHLATAAVVNAV
WDLWAKSVGKPVWKLLVDMSPEELVRCLDFRYVTDAITPYEALALLYRHAKTKGEREKEM
LAQGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVGGNLEEDVRRARILREEIG
ENLKLMMDANQVWDVDEAVANMRRLAEFDPWWIEEPTSPDDVLGHAAIRQRLGSIGVATG
EHCQNRVMFKQLLQAKAIDFCQVDSCRLGGLNEVLVVLLMAAKFGVPVCPHAGGVGLCEY
VQHISLFDYICVSASLENRVLEYVDHLHEHFVDPVVIRNGRYMPPQQPGYSIEMKAPSLE
TYVFPDGEAWQP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgattacgaggctgtccgttcgcgacattcgtttccccacttctcgttctctg
gatggctccgacgccatgaatgccgcgccggactattccgccacttacgtcacgctcgaa
accgattcgccacacaagctcactggacatggactgacctttacgatcgggcgcggcaat
gaaatctgcgtgacagcggtgaatgcgttgacgccgctgatcgtcggcaggaagcttgaa
gatatcgctgagaacatgggcgcattctggcgcgcctttacttcggatagtcaattgcgc
tggatcggtcccgataagggggcaatacatctggctacggccgcggtggtgaatgccgtg
tgggacctttgggcgaaatcggttggcaagcctgtgtggaagctgcttgtcgacatgagc
ccggaagaactcgtgcgctgtctggactttcgttacgtgacggacgcgatcacgccttac
gaagcgctagcgctgctgtatcgccacgcaaagactaaaggcgaacgcgaaaaggaaatg
ctcgcgcaagggtatccggcgtatacgacatcggcgggctggcttggttacgacgacgac
aagatccgccggctcgcgcgcgaaggcgttgcgcaagggtggacgcatttcaagcagaaa
gttggcggcaatctcgaagaagatgtgcgacgcgcccgcatcctgcgcgaagagatcggc
gagaacctgaagctgatgatggatgcgaatcaggtgtgggatgtcgatgaagccgtcgcg
aacatgcggcgtcttgcggagttcgacccatggtggatcgaagagcccacaagccccgac
gatgtactcggtcacgcggctattcgtcagcggctgggatcgatcggtgtggcgacgggc
gagcactgccagaaccgtgtgatgttcaagcagttgctgcaagccaaggcaatcgatttc
tgccaggtcgatagttgtcgtctgggcggactgaacgaagtactcgtcgtgttgctgatg
gcggcgaagttcggcgtgcccgtatgtccgcacgcgggcggcgtcggattgtgcgagtac
gtgcagcacatttcgctattcgactatatctgcgtgtcggcgtcgctggaaaaccgcgtg
ctggagtatgtcgatcatctgcacgagcatttcgtcgatcccgttgttattcgcaatggc
cgctatatgccgccgcaacagccgggatatagcatcgaaatgaaagcgccgtcactcgaa
acgtatgtcttccccgatggcgaggcatggcagccttga

DBGET integrated database retrieval system