KEGG   Panthera tigris altaica (Amur tiger): 102948684Help
Entry
102948684         CDS       T02988                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00071  Fatty acid degradation
ptg01212  Fatty acid metabolism
ptg03320  PPAR signaling pathway
ptg04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102948684 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102948684 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102948684 (CPT2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102948684 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3
Motif
Other DBs
NCBI-GeneID: 102948684
NCBI-ProteinID: XP_015390887
Position
Un
AA seq 859 aa AA seqDB search
MSWPRDKRTMDGMAYVGNTGLDTFPEIFPKSPHKFLMRTALVYDPVLRADHAVVGLRHSS
LGERRPWEHQVRPLFPTEVLLQEIQKGMSRRIFIVTVSVVTDIRGKFKFSHGFQNKIGKE
QNNTLIFQEDMISFMSDMNRDEEERILSVMGSLHLPGIWHSPVALLRRRMLTWGYGRRGL
LLPGKSMSENGHSWRMLKSSLIFLTLEELSTHRSEAEVRNLLPQGPETGRASSGVFEGWP
VTFLISGNIWSRLPIPKLEDTIKRYLRAQKPLLDDGQFRKTEQLCKSFENGIGKELHEQL
VAQDKQNKHTSYISGPWFDMYLSARDSIVLNFNPFVAFIPDPKSEYNDQLTRATNMTVSA
IRFLKTLRAGLLEPEVFHLNPAKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFR
LFNSTRLPKPIRDELFTNEKARHLLVLRKGHFYVFDVLDQDGNIVGASEIQAHLKYILAD
SSPAPEFPLAYLTTENRDVWAELRQKLASGGNEESLRKVDSAVFCLCLDDFPIKDLVHLS
HNMLHGDGANRWFDKSFNLIIAKDGTAAIHFEHAWGDGVAVLRFLNEVFKDSTQAPAVTP
QSQPARTDSSVAVQKLNFKLNDALKTGISTAKEKFDATVKTLTVDLIQFQRGGKEFLKKQ
KLSPDSVAQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTETIRPASIFTKRCSQAFVRE
PSKHSAGELQQMMTECSTYHSQLTKEAAMGQGFDRHLFALRYLAAAKGIALPELYLDPAY
GQINHNILSTSTLNSPVVNIGGFAPVVPDGFGIGYAVHDNWIGCNVSSYPGRNAREFLQC
VEKALEDIFDAIEGKCIKT
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggccccgggataagaggacaatggatggcatggcctatgtgggcaatacaggg
ctggacacattccctgaaatttttcccaaatcacctcacaaatttctaatgaggactgcc
cttgtgtatgaccctgtgctaagagctgaccacgcagttgtaggcctcaggcactctagt
ctgggggagagacggccctgggagcatcaagtccgccctttatttcccacggaagttctc
ttacaagagatacagaaggggatgtctaggaggatattcatcgtgacggtatctgtggta
acggacataagaggaaaattcaagttttctcatggatttcaaaataagattggcaaggaa
cagaataacacgctgattttccaagaagacatgattagcttcatgtcagacatgaataga
gatgaagaggaaagaattctctctgtgatgggaagtctccatctcccggggatctggcac
agccccgtggcattgctgaggaggagaatgctgacttggggctatgggcggagaggcctg
ctcctaccagggaagtccatgagtgaaaatggccacagctggaggatgctgaagtcgagc
ttaatcttcctcactttggaagagctgagtacacacaggagtgaagcagaagtcaggaat
ctattgccacagggtccagagacgggcagggcttcctcaggagtttttgagggctggcct
gtgactttccttatttcaggcaacatttggtccaggctgcctattcctaaacttgaagac
accattaagagatacctccgtgcacagaagcctctcttggatgatggccagttcaggaag
acagaacagctttgcaagagctttgaaaatgggattggaaaagaactgcatgagcagcta
gttgctcaggacaagcagaataaacatacgagctacatttcaggcccctggtttgatatg
tacctgtctgctcgagactccattgtcttgaattttaatccatttgtggcattcatccct
gacccaaagtctgagtataatgaccagctcaccagggcaaccaacatgactgtttctgcc
atccggtttctgaagacacttcgggctggtcttttggagccagaggttttccacttgaac
cctgcgaaaagtgacactgataccttcaagagactcatacgctttgtgccttcttctctg
tcctggtatggggcctacttggtcaatgcttatcccctggatatgtcccagtattttcgg
cttttcaattcaacccgtttacccaaacccattcgggatgaactctttactaatgagaag
gctaggcacctcctggtcctaagaaaaggacatttctatgtttttgatgtcctagatcaa
gacggaaacattgtgggtgcctctgaaatccaggctcatctgaagtacattctcgcagac
agtagtcctgcccccgagtttcccctggcgtatctgaccaccgagaaccgagacgtctgg
gcagagctcaggcagaagctggcgagtggtggcaatgaggaatccctgaggaaagtggac
tctgctgtgttctgtctctgcctagatgacttccccattaaggacctcgtccacttgtct
cacaacatgctgcatggtgacggtgcaaaccgctggtttgataagtcctttaacctcatt
atagccaaggacggcactgctgctatccactttgagcatgcttggggtgatggggtggcg
gtgctcaggtttcttaatgaagtgttcaaagacagcactcaggcccctgctgtcacccca
cagagccagccagcccgcacggactcttctgtcgccgtgcagaagcttaacttcaagctg
aacgatgccttaaagactggcatcagcaccgctaaggaaaagttcgatgccaccgtgaaa
accctcaccgtcgacctcatccagtttcagagaggaggcaaagagttcttgaagaagcag
aagctgagccctgactcggtggctcagctggccttccagatggccttcttgcggcagtat
gggcagacggtggccacctacgagtcctgtagcactgcagcattcaagcacggccgcacc
gagaccatccgcccggcctccatcttcaccaagaggtgttcccaggcctttgtcagggag
ccctccaagcacagtgctggagagcttcagcagatgatgaccgagtgctccacgtaccac
agccagctgaccaaagaagcagcaatgggccagggctttgaccgacacttatttgctctg
cgttacctggcagcagccaaggggattgctctgcctgagctatacctggaccctgcatat
gggcagataaaccacaacatcctgtccacgagcactctgaacagcccagtagtgaacatt
ggtggctttgcccctgtggtccctgatggctttggcattgggtatgctgttcatgacaac
tggataggctgcaacgtctcctcctacccaggccgcaatgcccgggagtttctccagtgt
gtagagaaggccttagaagacatatttgatgccatagaaggcaaatgcatcaaaacttag

DBGET integrated database retrieval system