KEGG   Panthera tigris altaica (Amur tiger): 102948685Help
Entry
102948685         CDS       T02988                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04064  NF-kappa B signaling pathway
ptg04370  VEGF signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04668  TNF signaling pathway
ptg04723  Retrograde endocannabinoid signaling
ptg04726  Serotonergic synapse
ptg04913  Ovarian steroidogenesis
ptg04921  Oxytocin signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg05140  Leishmaniasis
ptg05165  Human papillomavirus infection
ptg05167  Kaposi's sarcoma-associated herpesvirus infection
ptg05200  Pathways in cancer
ptg05204  Chemical carcinogenesis
ptg05206  MicroRNAs in cancer
ptg05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102948685 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102948685 (PTGS2)
   04064 NF-kappa B signaling pathway
    102948685 (PTGS2)
   04668 TNF signaling pathway
    102948685 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    102948685 (PTGS2)
   04657 IL-17 signaling pathway
    102948685 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102948685 (PTGS2)
   04913 Ovarian Steroidogenesis
    102948685 (PTGS2)
   04921 Oxytocin signaling pathway
    102948685 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102948685 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102948685 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102948685 (PTGS2)
   05206 MicroRNAs in cancer
    102948685 (PTGS2)
   05204 Chemical carcinogenesis
    102948685 (PTGS2)
   05222 Small cell lung cancer
    102948685 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102948685 (PTGS2)
   05165 Human papillomavirus infection
    102948685 (PTGS2)
   05140 Leishmaniasis
    102948685 (PTGS2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102948685 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102948685
NCBI-ProteinID: XP_007096301
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCQNQGVCLSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNIIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHVYGETLDRQHKLRLFKDGKMKY
QIIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgccctgctgctctgcgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgccaaaaccaaggtgtatgtctgagcataggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacctgaatttctg
acaagaataaagttattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcaaaatataattatgaaa
tatgtgttgacatccaggtcacatttgattgagagcccaccaacttacaatgtggactat
ggctataaaagctgggaagccttttccaatctctcctattataccagagctcttccccct
gtggctgatgactgcccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgacccccaaggcaca
aatatgatgtttgcattttttgcccaacacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgggccatggggtggacttaagtcatgtttat
ggcgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatac
cagataatcgatggggaggtgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccacctcacgttcctgaacacctgcggtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgatgagcggttgttccagacgagcaggcta
atactgataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccaataccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttgtctacaacaactctatatta
ctggaacatgggcttacccagttcgtggaatcattcagcaggcaaattgctggcagggtt
gctggtggtaggaatgttccagctgcagtgcagcaagtagcaaaggcctcaatcgaccag
agcagacagatgaagtaccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatacatcgtttgaagaactcacaggagagaaggaaatggctgcggggttagaagcactt
tatggtgatattgatgccatggagctgtatcctgcccttctggtagaaaagcctcgccct
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaagggctt
atgggtaatcctatatgctctcctgactactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcgattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcgcactctggactggatgatatcaatcccacagtactgctaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system