KEGG   Panthera tigris altaica (Amur tiger): 102948743
Entry
102948743         CDS       T02988                                 

Gene name
AHR
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04659  Th17 cell differentiation
ptg04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102948743 (AHR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102948743 (AHR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102948743 (AHR)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102948743 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 102948743
NCBI-ProteinID: XP_007089141
Position
Un
AA seq 853 aa
MNSSSSHITYASRKRRKPVQKTVKPIPPEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALQASPADRNGVQENCRTKFREGLSLQEGEFLLQA
LNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRPEFQRQLHWTLNPT
QCADSGQRIDEANGLPQPAVCYNPDQLPPENSSFMERSFVCRLRCLLDNSSGFLAMNFQG
RLKYLHGQNKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCD
AKGKLVLGYTEAELCMRGSGYQFIHAADMLYCAEYHIRMIKTGESGMIVFRLLTKDNRWT
WVQSNARLVYKNGRPDYIIATQRPLTDEEGTEHLRKRTMKLPFMFTSGEAVLYQVNNPFP
PMMDPLPVRTKTTACGRESATTSTLNKESFNPNSLLGAMMQQDESIYLYPASSNTAFERN
LFNEPMNECSNWQDSMAPVGNNSILKHEQIGQSQDMNPAISGGQSGPFADNRNSDLYSIM
KHLGIDFEDIKDMQQNEEFFRTDFSGEDDFRDIDLTDEILTYVQDSLSKPAFQCPGYQQQ
QAVAVNSSCMVQEHLQLEQQQQQQQRLQHQQNLVASEQQQQLCQKMQHMQVNGMFANWSA
NQSVPFGCPQQELQQYNVLSDLPGTSQECPYKSETDAMPYTHNFIPCDQSVLPQHSQGPQ
LDFPLGNFEPSPYPTTSNLEDFFTCLQAPENQTHGLTPEPPIVTPQTCYAGAVSMYQCQP
EPPHGHEAQMQYNPTMPDPQAFLNKFQNGGVLNETYPAELNNINSTQTPTHLQPLHHMSE
ARPFPDLTSSGFL
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaacagcagcagctctcacatcacctacgccagtcgcaagcggcggaagccggtgcag
aaaactgtcaagccaatcccacctgaaggaatcaagtcaaatccttccaagcgacataga
gaccgacttaatacagagttggaccgtttggctagcctgctgccttttccacaagatgtt
attaataagctggacaaactttcagttctcaggctcagtgtcagttacctaagagccaag
agcttctttgatgttgcattacaggcctccccagctgacagaaatggagttcaggaaaac
tgtagaacaaaattcagagaaggcctgagtctgcaagaaggagaattcttattacaggct
ctgaatggcttcgtgctggttgtcactacagatgctttggtcttttatgcttcttctact
atacaagattacttagggttccagcagtctgatgtcatacaccagagtgtgtatgaactt
attcacactgaagatcggcctgaatttcagcgtcagctgcactggacattaaaccctacg
cagtgtgcagactctggacaaagaattgatgaagctaatggcctcccgcagccagcagtc
tgttataacccagaccagcttcctccagaaaactcttcctttatggagaggagcttcgtg
tgccgactaaggtgtctcctggataattcatccggtttcctggcaatgaatttccagggg
aggttaaagtatcttcacggacagaacaagaaaggcaaagatgggtcaatccttccacct
cagttggctttgtttgcaatagctactccactgcagccaccctccatacttgaaattcga
accaaaaacttcatctttagaaccaaacacaaattggactttacacctactggttgtgat
gccaaaggaaaacttgttttaggctacactgaagcagagttgtgcatgagaggatcagga
tatcaatttattcatgctgctgatatgctttattgtgcagagtaccatatccggatgatt
aagactggagaaagtggcatgatagtattcaggcttctcaccaaagacaatcgatggacc
tgggttcagtctaatgcacgcttagtgtataaaaatggaagaccagattatatcattgca
actcagagaccactgacagatgaagaaggaacagagcatttacgaaaacgaactatgaag
ttgccttttatgtttacttctggagaagctgtgttataccaggtaaataacccttttcct
cccatgatggatcccttaccagtgaggactaaaactactgcttgtggaagagagtctgct
accacatcaactctaaataaggaatctttcaatcccaattccctcctgggtgccatgatg
caacaagatgagtctatttatctctatcctgcttccagtaacacagcttttgaaagaaat
ctttttaacgaacctatgaatgaatgcagtaattggcaagacagtatggcaccagtggga
aataacagtatcctgaaacatgagcaaataggtcagtctcaggatatgaacccagcaatc
tctggaggtcaatcagggccctttgcagacaacagaaatagtgacttgtacagcattatg
aaacacctaggcattgattttgaagatatcaaagacatgcaacagaatgaggaatttttc
agaactgacttttctggtgaggatgacttcagagatattgacctcacagatgaaatcctg
acctatgtccaagattctttaagcaagcctgccttccagtgtcccggttaccagcagcaa
caggccgtggctgtgaactcaagttgtatggtacaggagcacctgcagctagaacagcag
cagcagcagcagcagcggctgcagcaccagcaaaacctcgtagcatcggagcagcagcaa
caactgtgtcagaaaatgcagcatatgcaagttaatggcatgtttgccaattggagcgct
aaccagtctgtgccttttggttgtccgcagcaagagctacagcagtataatgtcctttca
gacttacctgggaccagtcaagagtgtccctacaaatctgagacggatgctatgccttat
acacacaactttatcccctgtgatcagtctgtgctgccacaacattcccaggggccacag
ttagactttcccttagggaacttcgaaccatccccgtaccctactacttctaatttagaa
gattttttcacgtgtttacaagctcctgagaaccaaacacacggacttactccagagccg
cccatagtaactcctcagacgtgttatgccggggctgtgtccatgtaccagtgccagccg
gaacctccgcacggccacgaggcccagatgcagtacaatccaacaatgccggacccacag
gcatttttaaacaagtttcagaatggaggagttttaaatgaaacctatccagctgaatta
aataatataaatagcactcagactcccacacaccttcagccccttcatcacatgtcagaa
gccagacctttccccgatttgacatccagtggattcctgtaa

DBGET integrated database retrieval system