KEGG   Panthera tigris altaica (Amur tiger): 102949132
Entry
102949132         CDS       T02988                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102949132 (DCK)
   00240 Pyrimidine metabolism
    102949132 (DCK)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102949132 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 CoaE
Other DBs
NCBI-GeneID: 102949132
NCBI-ProteinID: XP_007086989
Position
Un
AA seq 269 aa
MHSGHHQTRMATPPKRSCPSPATGFEGVRIKKIAIEGNIASGKTTFVNILKQVCEDWEVV
PEPVARWCNVQSAQDDCEELTPSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAC
LNGKLKDAEKPVLFFERSIYSDRYVFASNLYESDCMNETEWTIYQDWHDWMNHQFGQSLE
LDGIIYLRATPEKCLNRIYLRGRNEEQGIPLEYLEKLHEKHESWLLHRTLKTDFDFLQEI
PILTLDINEDFKDKHDSLVEKVKEFLSTL
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcactcgggccaccaccagactagaatggccaccccacctaagaggagctgcccgtct
cccgcgaccggctttgagggggtccgcatcaagaagattgccatcgaagggaacattgct
tcagggaagacaacatttgtgaatatccttaaacaggtctgtgaggattgggaagtggtt
cctgaacctgttgccagatggtgcaatgttcaaagtgcacaagatgactgtgaggaactg
acaccgtctcagaaaagtggtgggaatgttcttcaaatgatgtatgagaaacctgaacga
tggtcttttaccttccagtcatatgcctgcctcagtcgaatacgagcccagcttgcctgt
ctcaatggcaagctcaaagatgcagagaaacctgtattattttttgaacgatctatatat
agtgataggtatgtttttgcatctaatttgtatgaatctgactgcatgaatgaaacagag
tggacaatttatcaagactggcatgactggatgaatcaccagtttggtcaaagccttgaa
ctggatggaatcatttatcttcgagccacaccagagaaatgcttgaatagaatatattta
cggggaagaaatgaagaacaaggcattcctcttgagtatttagagaagcttcacgaaaag
catgagagctggctcctgcatagaaccctgaaaaccgactttgattttctacaagaaatc
cccatcttaacactggatattaatgaagactttaaagacaaacacgacagtctagttgaa
aaggtcaaagaatttttgagcactttgtga

DBGET integrated database retrieval system