KEGG   Panthera tigris altaica (Amur tiger): 102949388Help
Entry
102949388         CDS       T02988                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102949388 (DOCK6)
Membrane trafficking [BR:ptg04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102949388 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 102949388
NCBI-ProteinID: XP_007079405
Position
Un
AA seq 2039 aa AA seqDB search
MAHACRTPRGHAKEAGIPPNGLEDCHCLDGAETRRLDGTTVGASVDMEEAAWIFVSEKGF
IGPKWSSPGPTAQVFVSPVAPFCPRRTVAAEVRKQVSRERSGSPHSSRRSSGSLGVPLTE
VIEPLDFEDVLLSRPPDAEPGPLRDLAEFPADDLELLLQPRECRTTEPGTPEDGKLDAQV
RAAVEMYTEDWIIAHRRYQHLSAAFSPITTETQRERQKGLTRQVFEQDTSGDERSGPEDS
DDPRHSSGSLDDTPRSSGASGIFDLRNLAADSLLPSLLERTAPEDVDRRNEALRRQHRPR
ALLALYPAPDEDEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREK
KKISENFYFDLNSDSVKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQG
DISECCEPYMVMKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHPAHMMRPLL
AGLERRPAWTDRRRRGPQDRTSGGDDTCSFASFRPATLTVTNFFKQEAERLSDEDLFKFL
ADMRRPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFP
AREVYAPHTSYRNLLYVYPHCLNFSSRQGSVRNLAVRVQYMAGEDPSQALPVIFGKSSCS
EFTREAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVXXXXXXSXQWIPLLQH
GRLRTGPFCLPVSVDQLPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQDPHL
DKFFTLVHVLEEGAFPFRLKDTVLSEGTVEQELRASLAALRLASPQPLVAFSHHVLDKLV
HLVVRPPIIGGQIVNLGRGAFEAMAHVVSLVHRSLEAAQDARGHCPLLAAYVHYAFRLPG
TEPNFPSGAPPVAVQAATLARGPGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRILA
SKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGADPRQAIDCSSSRTSFYLEGSSLAPPAT
QPRPTVQKLLHEELALQWVVSGSAVRETVLQHAWFFFQLMVKSMALHLLLGQRLDTPRKL
RFPGRFLDDIAALVGSVGLEVITRVYKDAELAERLNASLAFFLSDLLSLADRGFVFSLVP
AHYKQVATRLQSAPNPALLLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSVSSTT
SQSSTFSSQAPDPKVTSMFELSGPFRQQHFLAGLLLTELALALEPEAEGASLLHKKAISA
VHSLLCGHDADPRYTEAAVKARVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLASMLDS
DTEGEGDIGGTINPSVAMAIAGGPLAPGSRASISQGPVAASRSGCPLSAESSRTLLVCVL
WVLKNAEPALLQRWAADLALPQLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLDMK
ARLEEAILGTIGARQEMVRRSRERSPFGNQENVRWRKSITHWRQTSDRVDKTKDEMEHEA
LVDGNLATEASLVVLDTLEIIVQTVMLSEARESVLGAVLKVVLYSLGSAQSALFLQHGLA
TQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTHASASLYLLMRQNFEIGNN
FARVKMQVTMSLSSLVGTTQSFSEEHLRRSLKTILTYAEEDVGLRDSTFAEQVQDLMFNL
HMILTDTVKMKEHQEDPEMLIDLMYRQNISSNVLEESAISDDILSPDEEGFCSGKHFTEL
GLVGLLEQAAAYFTMGGLYEAVNEVYKTLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQS
SGWERVFGTYFRVGFYGARFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGEDVVEI
VKDSNPVDKTKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRTFLFCTPFTPDGR
AHGDLPEQHKRKTLLSTDHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATE
QDPPDAKMLQMVLQGSGGPTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCFKDFCKK
NT seq 6120 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatgcctgcaggaccccgcgagggcacgcaaaggaggcagggatcccaccgaac
ggactcgaggattgtcattgtttagatggtgccgaaacccggaggctggatgggaccact
gtgggggcgagtgtggacatggaagaggcagcctggatttttgtctcggagaagggattt
attggcccgaagtggagttctccgggccccactgcccaagtgttcgtgtccccagtggcc
cccttctgtccccgcaggacggtggctgcggaggtacggaagcaggtgtcccgggagcgc
agtggctccccccactccagcagacgcagcagcggctccctgggggtcccactcactgaa
gtcattgagcccctggacttcgaggatgtgctcctgagccggcctccagatgccgaaccc
gggcccctccgggacctggccgagtttccagctgatgacctcgagctgctgttacagccc
cgggaatgccggaccacggagcccgggacccccgaggatggaaagctggatgcccaggtg
agggccgcggtggagatgtacacggaggattggatcatcgcccacaggaggtaccagcat
ctgagtgcagcgttcagccccatcaccacagagacgcagcgagagcggcaaaagggcctc
acccgccaggtctttgagcaggacacttctggggatgagaggtccggcccagaggactcg
gatgacccccgccactcctcgggctccctggatgacacccctcgaagtagtggggcctct
ggcatcttcgacctgaggaacttggcagctgactcattgctgccctcgctgctggaacgc
acagcccctgaagatgtggaccggcggaacgaggccttgcggcgacagcaccggccccgc
gccctgctggccctctacccagcacccgatgaggatgaggccgtggaacgctgcagccgc
cccgagccgccccgtgagcacttcggacagaggatcttggtcaagtgtctgtcgctgaag
tttgaaatcgaaatcgagcccatctttggcatcttggccctgtatgatgtgcgggagaaa
aagaagatctcagaaaacttctactttgacctgaactcggactctgtgaaggggctcctg
cgggctcatggcacccaccctgccatctccacgctggcccgctctgccatcttctccgtg
acctacccctcacctgatatcttcctggtcatcaagctggagaaggtgttgcagcagggg
gacatcagcgagtgttgcgagccatacatggtgatgaaggaggtggacacggccaagaac
aaagagaagctggagaagctgcgcctggcagccgagcagttctgcacccgcctgggccgc
taccgcatgcccttcgcctggaccgccgttcacccggcccacatgatgcgccctctgctg
gctggacttgagcgccgacctgcctggactgaccgccgccgtcgggggccccaggatcgg
acgagtggtggggatgacacctgcagcttcgccagcttccgcccagccacgctaactgtc
accaacttctttaagcaggaagctgagcggctcagcgatgaggacctcttcaagttcctg
gctgacatgcgacgcccatcctctctactgcggcgcctgcggcccgtgactgcccagctc
aagatcgacatctccccggctcccgagaacccgcacttctgcctctccccggagctgctt
catgtcaagccctacccagaccccaggggccggcccaccaaggagatcttggagttcccc
gcccgtgaggtctacgccccccataccagctacaggaacctgctgtacgtgtacccgcac
tgcctcaacttcagcagccgccagggctccgtgcgcaacctcgccgtgcgagtgcagtat
atggcgggcgaggaccccagccaggccctgccggtcatctttggcaagtcgagctgcagc
gaattcacccgcgaggccttcacaccggtggtctaccacaacaagtccccagagttctac
gaggagttcaagcttcgccttccggcctgcgtgaccgagaaccaccacctgctgttcacc
ttctaccacgtcagnnnnnnnnnnnnnntctccnnccagtggatcccgctgctgcagcac
ggccgcctgaggaccggccccttctgcctccctgtgtccgtggaccagctcccgcccagc
tactctgtgctcactccagacgtggcgctgccgggcatgcgctgggtggacggccacaag
ggcgtgttcagcgtggagctcactgctgtgtcctctgtgcacccccaggaccctcacctg
gacaagttcttcactctggtgcacgtcctggaggaaggggccttcccgttccgcctcaag
gacaccgtgctgagtgaggggactgtggagcaggagctgcgggccagcctagccgcactg
cgcctcgccagcccccagccacttgttgctttctcccaccacgtgctggacaagctcgtg
catctggtcgtgcggcctccaatcattggcggccagatcgtgaacctaggtcgtggggcc
ttcgaagcaatggcccatgtggtcagccttgtccaccggagcctagaggctgcccaggat
gcccgtggtcactgcccgctgctggctgcctatgtccactatgccttccgactgcctggc
accgagcccaacttcccaagtggggcccctccagtggcagtgcaggctgccacgctggcc
cgtggccctggccgccccgctagcctctacctggctcgctctaagagcatcagcagcagc
aacccggacctggccgtggcccctggctctgtggacgacgaggtctcccgcatcctggcc
agcaagggtatcgaccgctcacactcctgggtgaattcggcttatgctccaggaggcagc
aaggctgtgctgcgacgggcacccccttactgcggggccgaccccagacaggccatcgac
tgcagctctagccgaacttctttctacctcgagggctcctccttggccccaccggccacc
cagccgagacccactgtgcagaagctgcttcacgaggagctggccctgcagtgggtggtc
agcggcagcgccgtgcgagagacggtcctgcaacatgcctggttcttcttccagcttatg
gtgaaaagcatggccctgcacctgcttctgggccagcggctggacacgccccgcaagctt
cgcttccctgggcgcttcctggacgacatcgcggccctcgtgggctctgtgggcctggaa
gtcatcacccgggtatacaaggacgcggagctggccgagcgcctcaacgccagcctggcc
ttcttcctcagcgatctgctgtccctggcggaccgaggcttcgtcttcagcctggtccca
gcccactacaagcaggtggccacgcggctgcagtcggcccccaacccagcgttgctgctg
accctgcgcatggacttcacccgcatcctgtgcagccacgagcactacgtgaccctcaac
ctcccctgctgccccctgtcgcctccggcctcgccctcgccctctgtatcctccaccacc
tcccagagctccaccttctccagccaggccccagaccccaaggtgaccagcatgttcgag
ctgagcgggccattccggcaacagcactttctggctgggctcctgctgacggagctggcg
ctggccctggaacctgaggccgagggggcatccctgctgcacaagaaggccatcagtgcc
gtccacagtctgctctgtggccatgacgctgacccccgctacaccgaggctgccgtgaag
gcccgtgtggccgagctgtacctacccctgctgtcactcgcacgggacacgctgccacgg
ctgcatgattttgctgagggcccaggtcaacggtcaagactggcctcgatgctcgactca
gacacagaaggggaaggggacatcggaggcaccatcaacccctcagtggccatggccatc
gctggtggccccctagcccctggctcccgggctagcatctcccagggcccagtggcagct
tctcgctcaggctgccccctctctgctgagtccagccggaccttactggtgtgtgtgctg
tgggtcctgaagaatgctgagccagccctcctgcagcgctgggctgctgaccttgccctc
cctcagctgggtcgtctcttggacttgctgtacctttgcctcgctgcctttgagtacaag
gggaaaaaggcctttgagcgcatcaacagtctcacgttcaagaagtcactggacatgaag
gctcgtctggaggaagccatcttgggcactattggagcacgacaggagatggtccggcgg
agtcgtgagaggagtccctttgggaaccaggagaacgttcgctggcggaagagcatcaca
cactggagacagacctcagaccgtgtggacaagaccaaggatgaaatggaacacgaggcc
ttggtggacgggaacctggcgaccgaggcaagcctggtggttctggacacactggagatc
atcgtgcagacggtcatgctgtcagaggcccgggagagcgtcttaggcgcagtgcttaaa
gttgtgctgtacagtctgggcagtgcccagagtgccctcttcttgcagcatggcctggcc
acacagcgagccctggtgtccaagttcccagagctgctgttcgaggaggacacagagctg
tgtgccgatctctgcttgaggctcctgcgacactgcggcagccgcatcagcaccatccgc
acgcacgccagcgcctcactctacctcctcatgcgccagaatttcgagatcggcaacaac
tttgcccgcgtgaagatgcaagtgaccatgtcgctctcgtccctggtggggacgacacag
agcttcagtgaagagcacctgagacggtcactgaagaccatcctcacctatgcggaggag
gacgtggggctgcgggacagcaccttcgcggagcaggtccaggacctgatgttcaacctg
cacatgatcctgacggacacggtgaagatgaaggagcatcaggaggacccggagatgctc
atcgatctcatgtacagacagaacatctcatccaacgtgctagaggaatcggccatctcc
gacgacatcctgtcgcctgacgaggagggcttctgttccgggaagcacttcacggagctg
gggctggtgggactgctggagcaggcggcagcctacttcaccatgggcgggctctatgag
gcagtgaacgaggtctacaagaccctcatccccatcctggaagcccaccgagactacaag
aagctggctgccgtgcatggcaaactgcaggaggccttcaccaagatcatgcaccagagc
tctggctgggagcgtgtgttcgggacgtatttccgtgtgggcttctatggtgcccgcttc
ggcgacctggacgagcaggagtttgtgtataaagagccgtccatcacgaagctggctgag
atttcacaccggctggaggagttctacacggagaggtttggggaggacgtggtcgagatt
gtcaaagattcgaaccccgtggacaagaccaagcttgacccacagaaggcttacatccag
atcacttacgtggaaccgcacttcgacacctacgagctcaaggaccgggtgacttacttc
gaccgcaactacgggctgcgcaccttcctgttctgcacgcccttcacgcctgacgggcgc
gcgcacggggacctgccagagcagcacaagcgcaagactctgctcagcacagaccacgcc
ttcccctacatcaagacccggatccgcgtgtgccaccgcgaggagacagtgctgacaccc
gtggaggtggccatcgaagacatgcagaagaagacacgggagctggccttcgccaccgag
caggacccgcccgacgccaagatgctacagatggtgctgcagggctccggggggcccact
gtgaaccaggggcccctggaggtggcccaggtgtttctggcggagatcccggaagacccc
aaactcttcaggcatcataacaagctgcggctctgtttcaaggacttctgcaagaagtag

DBGET integrated database retrieval system