KEGG   Panthera tigris altaica (Amur tiger): 102950315Help
Entry
102950315         CDS       T02988                                 

Gene name
NTRK2
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102950315 (NTRK2)
   04010 MAPK signaling pathway
    102950315 (NTRK2)
   04151 PI3K-Akt signaling pathway
    102950315 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102950315 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    102950315 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102950315 (NTRK2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102950315 (NTRK2)
Protein kinases [BR:ptg01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   102950315 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Ig_C17orf99 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102950315
NCBI-ProteinID: XP_007091176
Position
Un
AA seq 838 aa AA seqDB search
MSSWTRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCTASRIWCSDPSPGIVAFPRLEP
NSADPENITEIYIANQKRLEIINEDDVEAYVGLKNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQETKSSPETQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGRSITLSCSVSGDPVPNLYWDVGNLVSKHM
NEMSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYK
LVAKNEYGKDEKQISAHFMGWPGIVDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVADKSGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggacgaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ctggttgtgggcttctggagggccgctctcgcctgtcccacgtcctgcaagtgcaccgcc
tctcggatctggtgcagcgacccttctccgggcatcgtggcgtttccgaggttggagcct
aatagtgcagaccctgagaacatcaccgaaatttacattgccaatcagaaaaggttggaa
atcatcaacgaagatgatgttgaagcttacgtaggactgaaaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcgtttctgaaaaacagcaacttacagcacatc
aattttacccgaaataaactgaccagcttgtctaggaaacattttcgtcaccttgatttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actcttcaggagactaaatccagcccagaaactcaggatttgtactgcctaaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatcagcaaat
ttggccgcacctaacctcactgtggaggagggaaggtctatcacgttgtcttgcagtgtt
tcaggcgatccagttccgaacttgtactgggatgtcggtaatctggtttccaagcatatg
aatgaaatgagccacacacagggctccttaaggataactaacatttcatctgatgacagt
ggaaagcagatctcctgtgtggcagaaaatcttgtaggagaagaccaagattctgtcaac
ctcactgtacattttgctccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagctcttcagtggttctataac
ggggcgatactgaatgagtccaagtacatctgtactaaaatccatgttaccaatcacacg
gagtaccatggctgcctccagctggataatcctactcacatgaacaatggggactacaag
ttagtagccaagaacgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaatcgtagatggtgccaacccaaattatcctgatgtaatttatgaagattat
gggactgcagcaaatgacattggggacaccacgaacagaagtaacgaaatcccttccaca
gatgtggcggacaaaagcggtcgggaacatctttcggtctatgctgtggtggtcattgcg
tctgtggtgggattttgtctgctggtgatgctgtttctgctgaagttggcaagacactcc
aagtttggcatgaaagatttctcatggtttggatttgggaaagtaaaatcaagacaaggt
gttggcccagcttcagttatcagcaatgatgatgactctgccagcccactccaccacatc
tccaatgggagtaacaccccatcatcttcagagggcggccccgatgccgtcattattgga
atgaccaagattcctgtcattgaaaatccccagtactttggcatcaccaacagtcagctc
aagccagacacatttgttcaacacatcaagcgacataacattgttctgaaaagggagcta
ggcgaaggagcctttggaaaagttttcctagctgaatgctataacctctgtcctgagcag
gacaagatcttggtggcagtgaagacgctgaaggacgccagtgacaacgcccgcaaggac
ttccaccgtgaggcagagctgctgaccaacctccagcacgagcacattgtcaagttctac
ggtgtctgtgtggagggcgacccgctcatcatggtctttgagtacatgaagcacggggat
ctcaacaagttcctcagggcccacgggcctgacgctgtgctgatggccgaaggcaacccg
ccgacagagctgacgcagtcccagatgctgcacatcgcccagcagatcgcggcgggcatg
gtctacctggcgtcccaacactttgtgcaccgagatctggccacccggaactgcctggtc
ggtgagaacctcctggtgaaaatcggggacttcgggatgtcccgggacgtgtacagcact
gactactacagggtcggtggccacacgatgttacccattcgctggatgcctccagagagc
atcatgtacaggaagttcaccacagaaagtgatgtctggagcctgggagtcgtgttgtgg
gagatcttcacgtacggcaaacagccctggtaccagctgtcgaacaacgaggtgatagaa
tgcatcactcagggccgagtcttgcagcgacctagaacatgcccccaggaggtgtatgag
ttgatgctggggtgctggcagcgagagccccacatgaggaagaacatcaagggcatccac
accctccttcagaacttggccaaggcatctccggtctacctggatattctgggctag

DBGET integrated database retrieval system