KEGG   Panthera tigris altaica (Amur tiger): 102951489Help
Entry
102951489         CDS       T02988                                 

Gene name
PARP9
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 9
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102951489 (PARP9)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102951489 (PARP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP
Motif
Other DBs
NCBI-GeneID: 102951489
NCBI-ProteinID: XP_007098370
Position
Un
AA seq 828 aa AA seqDB search
MDFSKVESGPGAVAYSEKSETATLEEGYGWQIPIDHNVFTILKNNESQLCEVLQNKFDCI
CTLISPSPEGNSESLQVFREMLIPGLELSVWRDDLTRHTVDAVVNAANEELIHAGGLAQA
LVNAGGPEIQEESRRFISRFGKIPTGNIVITRAGRLPCKLIIHAVGPRWVAKDRQRCVCK
LQKAIRNILNYVTLTESDVETVAIPALSSGIFQFPLDLCTQTIVETISFYFQRKQLAGNL
KEIHLVSNEYPTVVAFKNASEVILGVNKPGARVNQEATPPVNTIIVNNLTLQIVQGYIEQ
QETDVIVNSVNPLYGLKFGPVSTSILQQAGEEIELEFNQKITEIPQESQLVLITKGFKLS
CQYVYHVLWHLRYPKLTTTLGMAVNECLQKCLELNITSISFPALGTGSIGIWMNIAAKIM
FNEVLKFAKCHLKKQLTVKFVIFPEELEVYNAFSAEMAKSKSRLQGFNNYSVPQLTREEK
RENGLKSKSPAISLMGRNMEKMKEAQAWIRRILTLQDHHIIENYHILYLGKREHDILTQL
QNNLRVSISEIISLEKVILEIKGAQASLVEVVMNIEHMLCEVQEEMARKKELALWSLSGQ
WTDWQPKNQDEMKRNTFLKCLKLSTEEIQNQKKQFESCGLQVIKVEEIDNVFLMAVFQRK
KKMVEERTHRDPVSHRLFQQVPYQFCEAVCRVGFQRMYSMPCDPKYGVGIYFTKNLKNLA
YQVKNTSATDELIYVFEAEVLTGSFCQGHHLNIFPPPLSPGDIDSHDSVVDNVSNPETFV
IFSGTQAMPRYLWTCTQDHVQPQNDSAGPMMLSSQQPWERFSSGSSVD
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggacttttccaaggtagaaagtggtcctggagcagtggcttacagtgagaaatcagag
actgccactcttgaagaaggctatggttggcaaattcccattgatcacaatgtcttcaca
attttaaaaaataatgagagtcagctgtgtgaagtccttcagaataaatttgactgtatc
tgtaccctcatctctccatccccagaaggtaacagtgagtctctgcaagtcttcagagaa
atgctcattcctgggttggagttatctgtttggagggatgacctcaccagacacactgtt
gatgctgtggtgaacgcagccaatgaagaacttattcacgcaggaggcctggcccaggcc
ctggtgaatgctggaggccctgaaatccaagaggagagccgaaggtttatttccagattt
ggtaaaataccaactggtaacatagttatcacaagagcagggagacttccctgcaagtta
attatccatgctgtcgggccccggtgggtggcaaaagatcgtcagagatgtgtctgtaag
ctgcagaaggccattagaaatattctgaattatgtcacccttaccgagtcagacgttgag
acagtagcgattccagccctgagctctgggattttccagttccctctggacttgtgtaca
cagaccattgtggaaactatcagtttttatttccaaaggaagcaactggctggtaatttg
aaagaaattcacctggtaagcaatgagtaccctactgttgttgcctttaaaaatgcttca
gaagtaatcctaggggtgaacaagccaggagcccgggtgaaccaagaagccaccccacct
gtcaacacgattattgtaaacaatttgacgctccagattgtccagggctacattgaacag
caggagacagatgtaattgttaattctgtaaatccactgtatggtcttaagttcggaccc
gtgtcgacatcaattctacaacaagcaggagaagaaatagaattggaatttaaccaaaaa
attactgagatacctcaagagtctcagttggtactgatcacaaaaggatttaaattgtcc
tgtcaatatgtataccatgtgttatggcatttaagataccccaaactgacaacaacactg
ggaatggcagtgaatgaatgtttgcagaaatgccttgaattaaatatcacttccatttcc
tttcctgcccttgggactggaagcattggtatatggatgaatatagcagctaagattatg
tttaatgaagttttaaagtttgccaaatgccatttgaaaaaacaattaaccgtaaagttt
gtgatctttccagaagaactggaggtctataatgctttcagtgctgaaatggcaaagagt
aagtccaggctacagggtttcaataattacagtgtcccccagttgaccagagaggagaaa
agagaaaatgggctcaaaagtaaatctcctgccatcagcctgatgggacgcaacatggaa
aagatgaaggaggcccaagcgtggatccgaaggatactgaccctccaggaccaccacatc
attgagaattatcatatactctaccttggaaaaagggaacatgacattttgactcagctt
cagaataatttaagggtctctatctcagagattatcagtctggaaaaggtaattttagag
attaaaggagcccaggctagcctcgttgaggtggttatgaacattgaacatatgctgtgt
gaagttcaagaggaaatggcaagaaaaaaggagctagccctttggagcttgtcaggacaa
tggactgattggcaaccaaaaaaccaggatgaaatgaaaaggaatacatttctgaaatgc
cttaagctttcaactgaggaaattcagaatcagaagaaacagtttgaaagctgtggtttg
caggttataaaggtggaggaaattgacaatgtgtttctcatggctgtcttccaaagaaag
aagaaaatggtggaagaaagaacacatagggatcctgtgagccacaggttgtttcagcaa
gttccttaccagttctgtgaagcagtatgcagagttggctttcaaagaatgtactcgatg
ccctgtgacccaaaatatggagttggtatatacttcaccaagaatctgaaaaacctagca
taccaagtcaagaatacatctgccacagatgaactgatctatgtgtttgaagctgaagta
ctcacaggctccttctgtcagggtcatcatttaaatattttccccccaccgttgagtcct
ggagacatagatagccatgacagcgtggttgacaatgtctccaaccctgaaacctttgtt
atttttagtggcacacaggctatgcctcgatatttgtggacttgcacccaggatcatgta
caaccacagaatgactcagcaggaccaatgatgctatcttcacagcagccttgggaaaga
ttctcaagtggtagctctgttgattaa

DBGET integrated database retrieval system