KEGG   Panthera tigris altaica (Amur tiger): 102951503Help
Entry
102951503         CDS       T02988                                 

Gene name
EIF3C
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102951503 (EIF3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ptg03012]
    102951503 (EIF3C)
Translation factors [BR:ptg03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102951503 (EIF3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 102951503
NCBI-ProteinID: XP_007084134
Position
Un
AA seq 913 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPEQSADEDAEKNEEDSEA
SSDEDEDEDGVSAAAFLKKKPEAPSGDSRKFLKKMEDEDEDSEDSEDDEDWDTGSTSSDS
DSEEEEGKQTVLASRFLKKAPTTEEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNDGGE
WERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQI
ASENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWQKCLDCINELMDILFANPNIFV
GENILEESENLHNVDQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVC
AIIERVQRYLEEKGTTEEICRIYLRRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENE
GEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQH
ADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQ
EQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRV
GERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLV
RKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQ
TVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMR
RGGYRQQQSQTAY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtttttcaccaccggttcggacagcgagtccgagtcctccctgtcaggggag
gagctcgtcaccaaacccgtcgggggcaactacggcaaacagccgttgttgctcagtgag
gatgaagaagataccaagagagttgtccgaagcgccaaggacaaaaggtttgaggagctg
accaacctcatccgaaccatccgtaatgccatgaagatccgggatgttaccaagtgcctg
gaagagtttgagctcctggggaaagcatatgggaaggctaagagcatcgtggacaaggaa
ggtgtcccccggttctacatccgcatcctggctgacctggaggactatcttaatgagctg
tgggaagataaggaagggaaaaagaagatgaacaagaacaacgccaaggccctgagcacc
ctgcgtcagaagatccgaaaatacaaccgagattttgagtcccatattacaaattataag
cagaaccctgaacagtctgcagatgaagatgctgagaagaatgaggaggattcagaagcc
tcttcggatgaggatgaggatgaggatggagtcagcgctgcagctttcctgaagaagaaa
ccagaagccccttctggagacagtcgcaagttcctcaaaaaaatggaggatgaagatgag
gattcggaagattcagaggatgatgaagattgggacacgggttccacgtcttctgattca
gactcagaagaggaagaaggaaaacagaccgtgttggcctcaagattccttaagaaggcc
cctaccaccgaggaggacaagaaggcggccgagaagaaacgagaggacaaagccaagaag
aagcacgataggaaatctaagcgcctggatgaggaggaggaggacaatgacggcggagag
tgggaaagggtccgggggggtgtgccccttgttaaggagaaaccaaaaatgtttgccaag
ggaactgagatcacccatgctgttgtcatcaagaaactgaatgagatcctacaggcacga
ggcaagaagggaactgatcgtgcagcccagattgagctgctacagctgctcgttcagatt
gcatctgaaaacaacctgggagagggtgtcatagtcaagatcaagttcaatatcatcgcc
tctctttatgactacaacccaaacctggccacgtacatgaagcctgagatgtggcagaag
tgcctagactgcatcaatgagctcatggacatcctgtttgcaaaccccaacatctttgtt
ggagagaacattctggaagagagtgagaacctgcacaatgttgaccagccactgcgtgtc
cgtggctgtatcctaaccctggtagaacgaatggatgaagaatttaccaaaataatgcaa
aatactgatcctcactcccaagagtacgtggagcacctgaaggatgaggcgcaggtgtgt
gccatcattgagcgcgtgcagcgctacctggaggagaagggcaccactgaggagatctgt
cgcatctatctgaggcgcatcctccacacctactacaagtttgactacaaggcccatcag
cggcagcttaccccccctgagggctcctcgaagtctgagcaagaccaggcagaaaacgag
ggcgaggactccgctgtgctgatggagaggctgtgcaagtacatctatgccaaggaccgc
acagaccgtatccgcacgtgcgccatcctctgccacatctaccaccacgccctgcactcc
cgctggtaccaggcccgcgacctcatgctcatgagccacctacaggacaacattcagcat
gcggacccgccagtacagatcctgtacaaccgcaccatggtgcagctgggcatatgtgct
ttccgccaaggcctgaccaaggacgctcacaacgccctgctggacattcagtcgagcggc
cgggccaaggagcttctgggccagggtctgctgctgcgcagcctgcaggagcgcaaccag
gagcaggagaaggtggagcggcgccggcaggtgcccttccacctgcacatcaacctggag
ctgctggagtgcgtgtatctggtgtccgccatgctcctggagatcccttacatggctgcc
cacgagagtgatgctcgccggcgcatgatcagcaagcagttccatcaccagctgcgcgtg
ggcgagcggcagcccttgctgggtccccctgagtcaatgagggaacatgtggtggctgcc
tccaaagctatgaagatgggcgactggaagacctgccacagtttcatcatcaatgaaaag
atgaatggcaaagtgtgggaccttttccctgaggctgacaaagtccgaaccatgctggtt
aggaagatccaggaagagtcactgcggacctacctcttcacctacagcagtgtctatgac
tccatcagcatggagaccctgtctgacatgtttgaactggacctgcccaccgtgcactcc
atcatcagcaagatgatcattaacgaggagttgatggcctccctggaccagccgacgcag
accgtggtgatgcatcgcaccgagcccaccgcccaacagaacctggctctgcagctggct
gagaagctgggcagcctggtggaaaataacgagcgggtgtttgaccacaagcaggggacc
tacggtggctatttccgagaccagaaggacggctaccgcaaaaacgagggctacatgcgc
cggggtggctaccgccagcagcagtctcagacagcctactga

DBGET integrated database retrieval system