KEGG   Panthera tigris altaica (Amur tiger): 102952035
Entry
102952035         CDS       T02988                                 

Gene name
ARNT2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952035 (ARNT2)
   05202 Transcriptional misregulation in cancer
    102952035 (ARNT2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102952035 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102952035 (ARNT2)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102952035 (ARNT2)
SSDB
Motif
Pfam: PAS PAS_3 PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 102952035
NCBI-ProteinID: XP_015391237
Position
Un
AA seq 682 aa
MASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSEI
ERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPS
FLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDD
VEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCVRAPDFVL
PIKRPSHGCSFFRNGLGPVKDGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKYCL
VAIGRLQVTSSPVCMDMSGVSVPTEFLSRHSSDGVITFVDPRCISVVGYQPQDLLGKDIL
EFCHSEDQSHLRESFQQVVKLKGQVLSVMYRLRTKNREWLLIRTSSFTFQNPYSDEIEYV
ICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQER
DPRFAEMFAGISASEKKMMTSASAAGTQQIYSQGSPFPPGHSGKAFSSSVVHVPGVNDIQ
SSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSGKTQSSPFGIGTSHTYPADPS
SYSPLSSPATSSPSGNAYSSLASRTPGFGRWGVRAGIPGGAGRVLSAHPEFGGPSPQLPE
PWDQVWRFPSASCPALGVRWYS
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggcttcggacatccctggatcggtgacattgcctgttgcccccatggcggccacggga
caggtgaggatggcgggagccatgcccgcccgtggaggaaagcggcgttccgggatggac
tttgacgacgaagacggagaaggacccagcaaattttccagagagaaccacagcgagatc
gagcggcggcggaggaacaagatgacccagtacatcacggagctgtcggacatggtgccc
acgtgcagcgcgctggcccggaagccggacaagctgaccatcctccgcatggccgtgtcg
cacatgaagtccatgaggggcacagggaacaagtccacagacggcgcctacaagccgtcg
ttcctgacggagcaggagctgaagcacctcatcctggaagcagccgatggctttctgttt
gtagtggcggcagagacgggacgggtcatttacgtgtctgactccgtcacccctgtgctg
aaccagccccagtcagagtggtttgggagcaccctgtacgagcaggtgcaccccgacgat
gtggagaagctgagagagcagctgtgcacctccgaaaactccatgacaggccggatcctg
gacctgaagacggggacggtgaagaaagagggacagcagtcctccatgaggatgtgcatg
ggctcgcggaggtccttcatttgcaggatgaggtgtgtgcgggcgcctgacttcgtcctc
ccaataaagcggccgtctcacggatgctctttcttcaggaacggccttggccccgtgaaa
gacggggaggcccagtacgccgtggtgcactgcacgggttacatcaaggcgtggcccccc
gcagggatgactatacctgaggaggacgcggacgtggggcagggcagcaagtactgcctc
gtggccatcggaagactccaggtgaccagctctcccgtgtgcatggacatgagcggggtg
tcggtgcccacggagttcttatcccgacacagctctgatggggtcatcacgttcgtggac
ccccggtgcatcagcgtggttggctaccaaccccaggatctcctcggaaaggacattttg
gaattctgccactcagaggatcagagccacctgcgcgagagcttccagcaggtggtcaaa
ctgaagggccaggtgctgtcggtcatgtaccggctccgcaccaagaaccgggagtggctg
ttgatccgcaccagcagcttcacgttccagaacccctactccgacgagatagagtacgtc
atctgcaccaacaccaacgtcaagcagctccagcagcagcaggcagagttggaggtgcac
cagagagatgggctgtcctcatacgacctgtcgcaggttcctgtccccaacctcccggcc
ggcgttcacgaggcggggaagtccgtggagaaggccgatgccatcttctcccaggagaga
gacccccggtttgctgagatgtttgcgggaatcagtgcgtcggagaagaagatgatgact
tcagcctctgcggcgggaacccagcagatctactcccagggaagcccgttcccccccgga
cactcggggaaggccttcagctcttccgtggtccacgtgcctggtgtgaatgacatccag
tcctcctcgtcaacgggccagaacatgtcccaaatctcccgacagctgaaccagagtcag
gtggcgtggacagggagccggccgccctttcccggacagcaaatcccttcccagtctggc
aagactcagtcgtctccctttgggattggaacgagccacacgtacccagcagacccctct
tcctacagccctctctccagcccagctacgtcctcgcccagcgggaacgcctactccagt
ctcgccagcaggactccggggttcggtaggtggggcgtgagggcgggaattcccggggga
gccggcagagtgctttctgcacatcccgagttcgggggaccgagcccccagctcccagag
ccctgggaccaggtctggaggtttccaagcgcctcctgtccagctctgggggtccggtgg
tattcctaa

DBGET integrated database retrieval system