KEGG   Panthera tigris altaica (Amur tiger): 102952825
Entry
102952825         CDS       T02988                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102952825 (AHRR)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102952825 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102952825
NCBI-ProteinID: XP_015395346
Position
Un
AA seq 718 aa
MMIPPGECMYAGRKRRKPIQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVS
KLDKLSVLRLSVSYLRVKSFFEAVQKCPRQPATGTPSPEDSGLSGGSTVLEGRLLLESLD
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
VFGQPLHSDTGPFPDVSTPVMSFLKLFLPSLPNFLLRPDQRELEASPKMLPSQGPTSPIT
MQFQGKLKFLFGQKRKTPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVS
GSVDTKAKAASSLCDPASHGKPHCLAGRSIGENISVLKAQADAGCWARVPARAPCPCLRS
SPDLVSDPEGAAGDRGGEEHGGVPGSTPGARGRRERPAYSCCFEAPGPVRHLNWMTGKHG
PDGGTNVKLGPSKSDPFSTHTVSRGSCVSCPGVQGTVHSSGVTAFRNSPGCHPGSHSPSA
YASRTSRALQDGCKGPPLPSCPFPQGSLDNGLPPPRGQRLAAGGYSTEDAKFRGGPVPAG
APCNPMLSLDVPVKLENDSGSEDAADGYLVSPGQVWLGGRQVVAFPTRIHLKTESDSRPH
LYAPHLGHSMLGAHLSGRAPLRPGKEPAPLRPAHCACLQHVHGLPEPDPPRHLCAHGHQP
PTLGCDCRAPGTTPVVKREPLDSPPWASHSQGGVPGMFPRSALPTLMPPKAPECAFLP
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgatgattccaccaggggagtgcatgtatgctggaaggaaaagaaggaagcccattcag
aaacagaggccggccacgggggctgagaagtcaaacccgtccaagcggcaccgggaccgc
ctcaacgccgagctggaccacctggccagcctgcttccgcttcctcctgacatcgtgtct
aagctggacaagctttctgtcctgcgtctcagcgtcagctacctcagggtgaagagcttc
tttgaagccgtgcagaagtgcccacggcagccggcgactggtaccccctcaccagaagac
agcggtctgagcggagggtccaccgtgctggagggaaggctgctgctggagtctctcgat
ggctttgccctggtcgtgagtgcggaaggcatgatattttatgcgtcagcaacgatcgtg
gactatctgggcttccaccagacggacgtgatgcaccagaacatctatgactatatccac
gtggatgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggcg
gtgtttgggcagcccctgcactcagacacaggccccttcccagatgtcagcaccccagta
atgtccttcctgaagctcttcttgcccagcctccccaactttctgctccgccctgaccag
cgagagttggaggcctcacccaagatgctgccctcccagggtcccacatcacccattaca
atgcagtttcaaggaaaactaaaattcctgtttggacagaagaggaagactccatcaggg
acagtcctgccccctcggctgtcactgttctgcatcgtggtgcccgtcctccttccttcc
gtggcggagatgaaaatgaagagtgcgtttctgagagtgaagcacagggtggacgtctca
ggctcagtggacacaaaagcaaaagccgcctcgagtctgtgtgacccagcatcgcatgga
aaaccccactgcctagcagggaggagcattggagaaaacatttcagtgctcaaggcacaa
gcggatgcaggctgctgggcccgggttccagccagagccccatgtccctgcctcaggagc
agcccggacctcgtttctgaccccgagggggccgcaggggacaggggaggagaggagcac
gggggggtgcctggcagcactcccggagccagggggcggagggaaagacctgcgtatagt
tgctgctttgaggcgcctggacccgtgaggcacctgaactggatgacagggaaacatggt
ccagatggtggcaccaacgtgaagctgggacccagtaagagtgacccgttctccacacac
actgtgtcccgtggctcctgcgtgtcctgccccggtgttcagggcactgtccatagcagt
ggggttactgctttccggaattcacccggctgtcacccaggaagccactctcccagtgcc
tatgccagccgcacgagcagagccttgcaggacggctgcaaggggccccctctgcccagc
tgccccttcccccaggggagcctggacaatgggctccctccgcccagagggcagcgtctc
gcagcgggaggctattccaccgaggacgccaagtttcgaggggggccggtgcccgcggga
gccccatgcaaccccatgttgtcacttgatgtgcccgtcaagctggagaacgactctggg
tctgaggacgcagcagacggctacctcgtgtccccaggccaggtgtggctggggggccgc
caggtggtcgctttccctaccaggatacacctgaagacagagtcagactccagaccccac
ctctatgctccacacctggggcacagcatgctgggggctcacctgagcggcagggctcca
ctcagacccggcaaggagccggcgcccttacgccccgcacactgtgcctgcctgcagcat
gtgcatggccttcccgagccagatcctccccgccacctctgtgcacacggtcaccagccc
cctacactgggctgtgactgcagagctcccggcaccacacccgttgtcaagcgcgagccc
ctggactcacccccgtgggcaagccacagccagggtggggtgcccggcatgttccccaga
agtgccttgccaacactgatgccccccaaagcccccgagtgtgctttcctgccgtag

DBGET integrated database retrieval system