KEGG   Panthera tigris altaica (Amur tiger): 102953226Help
Entry
102953226         CDS       T02988                                 

Gene name
QRSL1
Definition
(RefSeq) glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00970  Aminoacyl-tRNA biosynthesis
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102953226 (QRSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptg03029]
    102953226 (QRSL1)
Enzymes [BR:ptg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102953226 (QRSL1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102953226 (QRSL1)
Mitochondrial biogenesis [BR:ptg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102953226 (QRSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 102953226
NCBI-ProteinID: XP_007085550
Position
Un
AA seq 527 aa AA seqDB search
MLGRTLQEVSAALKQGQITPVELCQKCLSLIKKTKFLNAYITISEEVALKQAEESEKRYK
KGHSLGALDGIPVAVKDNFSTSGIETTCASNMLKGYVPPYNATVVQRLLDQGAVLMGKTN
LDEFAMGSGSTDGVFGPVKNPWSYSKQYREKRKQKSHGENEDSNWLITGGSSGGSAAAVS
AFTCFAALGSDTGGSTRNPAAHCGIVGFKPSYGLVSRHGLIPLVNSMDVPGILTRCVDDA
ATVLGVLAGHDPKDSTTIQDPGKPFMLSSLTDVSKLCIGIPKEYIVPELSSEVRSFWSKA
ANLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLEYGHRCDIDVSTEAMY
AATRREGFNDVVRGRILAGNFFLLKENYANYFIKAQKVRRLIANDFVNVFNSGVDVLLTP
TTLSEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSVPVALSNQGLPVGLQFIGRA
FCDQQLLTVAKWFEKQVQFPVIHLQELMDDCSSVFEIEKLASVSLKQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctgggccggaccctccaagaagtttctgcagcgctgaaacaaggccaaattactcca
gtagagctctgtcaaaaatgtctctcccttatcaagaagaccaagtttctaaatgcttac
attactatatcagaagaggtggccttaaagcaagctgaagaatcagagaaaagatacaag
aaaggtcactccctcggggctttagatggaattcctgttgcagtaaaagacaactttagc
acatcaggcattgagacaacatgtgcatcaaacatgctgaaaggttatgtaccaccttat
aatgctacagtagttcagaggttgttggatcagggagctgtcctgatgggaaaaactaat
ttagatgagtttgcaatgggatctggaagcacagatggtgtatttggcccagttaaaaac
ccctggagttactcgaaacaatatagagaaaagaggaagcagaagtcccatggtgagaat
gaggattcgaattggcttataactggaggaagctcgggtgggagtgcggcggcagtatca
gccttcacgtgtttcgcggctttaggatcagatacaggaggatcgaccagaaatccagct
gcccactgtgggattgttggtttcaaaccaagctatggcttagtttctcgtcatggtctc
attcccctggtgaattccatggatgtgcctggaatcttaaccagatgtgtggatgatgca
gcaactgtgttgggtgtgctggctgggcatgaccccaaagattctaccacaatacaagat
cctggtaaaccatttatgctttccagcttgacagatgtgagcaaactatgtattggaatt
ccgaaggaatatattgtaccagaattatcaagtgaagtgcgatctttttggtccaaagct
gctaacctctttgagtctgagggggcgaaagtaattgaagtgtccctgccccacaccagt
tattcaattgtctgctaccatgtattgtgtacatcagaagtggcatcaaatatggcaaga
tttgacgggctagaatatggtcacaggtgtgacattgatgtgtctactgaagccatgtat
gctgcaaccaggcgagaagggtttaatgatgtggtgagaggaaggattcttgcaggaaac
tttttcttactaaaagaaaactatgcaaattatttcatcaaagcacagaaagtgagacgg
ctcattgctaatgattttgtgaatgtttttaactctggagtggatgtcttgctgaccccc
accaccttgagtgaggcggtgccatacctggagttcattaaagaggacaacaggacacga
agcgcccaggatgatatttttacacaggctgtaaatatggcaggattgccagcggtgagt
gtccctgtggcgctctcaaaccaagggttgccagtaggactacagtttatcggacgtgca
ttttgtgaccagcagcttcttacagttgccaagtggtttgaaaaacaagtacagtttcct
gttattcatcttcaagagctaatggatgattgctcatcagtctttgaaattgaaaagtta
gcttctgtttctctaaaacagtag

DBGET integrated database retrieval system