KEGG   Panthera tigris altaica (Amur tiger): 102953393Help
Entry
102953393         CDS       T02988                                 

Gene name
TNKS2
Definition
(RefSeq) tankyrase 2
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptg03032]
    102953393 (TNKS2)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102953393 (TNKS2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102953393 (TNKS2)
DNA replication proteins [BR:ptg03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102953393 (TNKS2)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     102953393 (TNKS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank Ank_2 Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 102953393
NCBI-ProteinID: XP_007080156
Position
Un
AA seq 1282 aa AA seqDB search
MGQRRLPRKKQYLGQCLKMSSQEGWQGEDDPGRGCDMCKHIKHESLWHFGNHEEFCIARG
HIEMRQCWERSLEVDVGQVMEAEPQGTAQTLYVVNAAFATETPLQKWRTSSLSRWKCCRK
AALSSQLSLGIVLPEEKWPKIIPPSKGSSYLVTDRCRRLGPPRKCNGPDPAGRKSTPLHF
AAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVGLLLRHGADPNARDNWN
YTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLES
ARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGD
LVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPT
LLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKHPQTH
ETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVVKHEA
KVNALDNLGQTSLHRAAHCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEG
IPLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEY
LLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGK
YEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKL
SSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGH
VDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL
VSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATGDALSSGPSSPSSLSAASSLDNL
SGSFSELSSVVSSSGTEGASSLEKKEVPAVDFSITQFVRNLGLEHLMDIFEREQITLDVL
VEMGHKELKEIGINAYGHRHKLIKGVERLLSGQQGLNPYLTLNTSGSGTILIDLSPDDKE
FQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHA
NERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVH
KDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRG
EQAYPEYLITYQIVRPEGMVDG
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagagaaggcttccaaggaaaaaacagtacctgggccagtgtttaaaaatgagt
agccaagaaggttggcaaggggaggatgatccaggcagagggtgtgatatgtgcaagcac
ataaagcatgagagtttatggcactttgggaaccatgaggagttttgcatagccagaggg
cacattgagatgagacagtgctgggagaggagtctggaagtggatgtgggccaggtcatg
gaggcggaacctcagggaactgcccagactctgtatgtggtaaatgctgcatttgccact
gagacccctctccagaaatggaggacttcttccctcagccgctggaagtgctgcaggaag
gcagccctcagctctcagctttctttgggcattgttttgcctgaagaaaaatggcccaag
atcatacctccttccaaaggtagctcatatctggtaactgatcggtgcaggaggctaggg
cccccccgaaagtgcaacggccccgacccggcgggcaggaaatccaccccgctccacttc
gccgcaggttttgggcgtaaagatgtggttgaatatttgcttcagaatggtgcaaatgtc
caagcacgtgatgatggagggcttattcctcttcataatgcatgttcttttggtcatgct
gaagtagtcggtctccttttgcgacatggtgcggacccaaatgctcgtgataattggaat
tatactcccctccatgaagctgcaattaaaggaaagattgatgtttgcattgtgctctta
cagcacggagctgagccaaccatccgaaatacagatggaaggacagcgttggatttagca
gacccgtctgccaaagcagtgctgactggtgaatataagaaagatgaacttttggaaagt
gccaggagtggcaatgaagaaaaaatgatggctcttcttacaccattaaatgtcaactgc
catgcaagtgatggcagaaagtcaactccattgcatttggcagcaggatacaacagagta
aaaattgtacagctgttactgcaacacggagccgatgtccatgctaaagacaaaggtgat
ctggtgcccttacacaatgcctgttcttatggtcattatgaagtaactgaacttctggtc
aagcatggtgcctgtgtaaatgcaatggacttgtggcaattcactcctcttcatgaggca
gcttcaaagaacagggttgaagtgtgttctcttctcctaagttatggtgcagatccaaca
ctgctgaattgtcataataaaagtgctatagacttggctcccacaccacagttaaaagaa
agattagcatatgaatttaaaggccactcgttgctgcaggctgcacgggaagctgatgtt
acacgaatcaaaaaacatctctctctggaaatggtgaatttcaagcatcctcaaacacat
gaaacagcattgcattgtgctgccgcatctccgtaccccaaaagaaagcaaatatgtgaa
ctcttgctaagaaaaggagcaaacatcaatgaaaagactaaagaattcttgactcctcta
cacgtggcatctgagaaagctcataatgatgttgtcgaagtagtagtgaaacatgaagca
aaggttaatgctctggataatcttggtcagacttctctgcacagagccgcacattgtggt
catctgcaaacctgccgcctactcctgagctatgggtgtgatcctaacatcatatccctt
cagggctttactgccttacagatgggaaatgaaaacgtgcagcaacttcttcaagagggc
atcccattaggcaattcagaggcagacagacaattgctggaagctgcaaaggctggcgat
gtagaaactgtaaaaaaattgtgcaccgttcagagtgtcaactgcagagacattgaaggg
cgtcagtctacaccactccattttgcagctggctacaatagggtgtctgtggtggagtat
ctgctgcagcacggagctgatgtgcatgctaaagataaaggaggccttgtacctttgcac
aatgcatgttcttatggacattatgaagttgcagaacttcttgttaagcatggagcagta
gttaatgtagctgatttatggaaatttacacctttacatgaagctgcagcaaaaggaaag
tatgaaatttgcaaactcctactccagcatggtgcagaccctacaaagaaaaacagggat
ggaaatactcctttggatcttgttaaagatggagatacagacatccaagatctgcttcgg
ggagacgcagctttgttagatgctgccaagaagggttgtttagccagagtaaagaagttg
tcttctcctgataacgtaaattgccgtgatacccaaggccgacattcaacacctttacat
ttagcagccggttataataatttagaagttgcagagtatttgttgcaacatggagccgat
gtgaatgcccaagacaaaggaggacttattcctttacataatgcagcatcttatgggcat
gtagatgtagcagctttactaataaagtataatgcgtgtgtcaatgctacggacaagtgg
gctttcacacctttgcatgaagcagcccaaaagggacgaacacagctttgtgctttgctg
ttggcccacggagccgaccctactcttaaaaatcaggaaggacaaacgcctttagattta
gtttcagcagatgatgttagcgctctcctgacagcagccatgcccccttctgctctgcct
tcatgttataaacctcaagtgctcaatggtgtgagaagcccaggagctaccggagatgct
ctgtcttcaggtccatccagcccatcaagtctttctgcagccagcagtcttgacaactta
tctgggagtttttctgaactgtcttcagtagttagttcaagtggaacagagggtgcctct
agcttggagaaaaaggaggttccagcagtagattttagcataactcaatttgtaaggaat
cttgggcttgagcacctgatggatatatttgagagagaacagatcaccttggatgtgtta
gttgagatggggcacaaggagctgaaggagattggaatcaatgcttatggacatagacac
aaactaatcaaaggagttgaaagacttctctctggacaacaaggtcttaacccatactta
actctgaacacctctggaagtggaacaattctcatagatctatctcctgatgataaagag
tttcagtctgtggaggaagagatgcaaagtacagtccgagagcacagagatggaggtcat
gcaggtggaatcttcaacagatacaatattctcaagattcagaaagtttgtaacaagaaa
ctgtgggaaagatacacccacagaagaaaagaagtttctgaagaaaaccacaaccatgca
aatgaaagaatgctatttcatggatctccctttgtgaatgcgattatccataaaggcttt
gatgaaaggcatgcctacataggtggcatgtttggagctgggatttattttgctgaaaac
tcttccaaaagcaatcagtatgtatatggaattggaggaggtactgggtgtccagttcat
aaagacagatcttgttacatttgccacaggcagctgctcttttgccgggtaaccctggga
aagtctttcctgcagttcagtgcaatgaaaatggcacattctcctccaggacatcactca
gtcactggtcgacccagtgtaaatggactagctttagctgaatatgttatttacagagga
gaacaggcttaccctgaatatttaattacttaccagattgtgaggcccgaaggtatggtt
gatggataa

DBGET integrated database retrieval system