KEGG   Panthera tigris altaica (Amur tiger): 102954127Help
Entry
102954127         CDS       T02988                                 

Gene name
TBX6
Definition
(RefSeq) T-box 6
  KO
K10180  T-box protein 6
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102954127 (TBX6)
   03019 Messenger RNA biogenesis [BR:ptg03019]
    102954127 (TBX6)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Other transcription factors
   T-box
    102954127 (TBX6)
Messenger RNA biogenesis [BR:ptg03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102954127 (TBX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 102954127
NCBI-ProteinID: XP_007093527
Position
Un
AA seq 436 aa AA seqDB search
MYHPRELYPSLGTGCCLGPPQPGADSSFPPALAEGYRYPDLDTPKLDCFLSGIEAAPCPL
AAPPPLPPLPPALGTEPAPPAPDALHSLPGVSLSLENRELWKEFNSVGTEMIITKAGRRM
FPACRISVTGLDPEARYLFLLDVVPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPA
TGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGVASFR
FPETTFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPVATEA
YGSGDAPGGPCDSTLGGDVRESDPEQVPAPREAAQAPAPPCGGSSAEAYLLHPAAFHGAP
SHLPTRNPSFPEAADSGRPAPYSAAFLELQPGPGGSGYPAAAPPAPFASHFLQGGPFPLP
YPGPGAYLDVGSKPMY
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatccacgagagttgtacccctccctggggacaggctgctgccttgggcccccc
cagccgggagcagattccagcttcccgcctgctctggcagagggctaccgctaccctgat
ctggacactcccaaattggattgcttcctctccgggattgaggctgctccctgccccctg
gccgctcccccacccctgcccccgctgcccccagccctgggcactgagcccgccccccca
gccccagacgcccttcattcgctccctggagtcagcctgagcctggagaaccgggagctg
tggaaagagttcaattccgtgggaacagagatgatcatcaccaaagctgggaggcgcatg
ttccctgcttgccgaatatcagtcactgggctggaccccgaggcccgctacctgtttctc
ctggatgtggttccagtggatggggctcgctaccgctggcagggccggcgctgggagccc
agtggcaaggccgagccccgcctgcctgaccgcgtctacattcaccctgactctcctgcc
actggtgcccactggatgcggcagcccgtgtctttccatcgtgtcaagctcaccaacagc
acgctggacccccatggccatctgatcttgcactccatgcacaagtaccagccccgcata
cacctggtgcgggcagcccagctttgcagccaacactgggggggcgtcgcctccttccgc
ttccccgagaccacattcatctctgtgacagcctatcagaacccgcggatcacacaactg
aagatcgcagccaatccctttgccaagggcttccgggagaatggcagaaactgtaagagg
gagcgagatgcccgtgtgaagaggaaactgaggggcccagagccagtggccacagaggcc
tatgggagtggagatgcaccggggggcccctgtgattccacactggggggggacgtccgt
gagtcagatcccgagcaggtcccagccccccgcgaagcggcccaggccccggctcctccg
tgtggcggctccagtgccgaagcctaccttctgcaccctgccgctttccacggggctccc
agtcaccttccaaccaggaaccccagcttccctgaggctgcggactctgggcgcccggcc
ccctactcggccgcattcctggagctgcagcctgggcccgggggctcaggatacccagca
gctgcacccccagcccccttcgcctcgcacttcctccagggggggcccttcccccttccc
taccccggccctggggcttacctggacgtgggctccaaacctatgtactga

DBGET integrated database retrieval system