KEGG   Panthera tigris altaica (Amur tiger): 102954508Help
Entry
102954508         CDS       T02988                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptg01002]
    102954508 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102954508 (ABHD12)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102954508 (ABHD12)
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102954508 (ABHD12)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102954508 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 102954508
NCBI-ProteinID: XP_007096681
Position
Un
AA seq 354 aa AA seqDB search
MRPGDGHSPEMKLQLRLDFRRKGLWFRLRKILLCVLGLYVAIPFLIKLCPGIQAKLIFLN
FVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKDAQGKDQMWYEDAL
ATGHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDA
LHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKS
HPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCSLLILHAEDDPVVPFQLGRKL
YNIAAPSRSFRDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPGRQH
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctggagatggccattctcctgagatgaagctgcagctacgattggacttcagg
agaaagggcctgtggttccgactgaggaagattcttctctgtgttctggggttgtatgtt
gccattccatttctcatcaaactatgtcctggaatacaggccaaactgattttcttgaat
tttgtgagggttccctatttcattgacttgaaaaaaccgcaggatcaaggtttgaatcac
acgtgtaattactacctccagccagaggaagacgtgaccattggagtctggcacactgtc
cctgccgtctggtggaaggacgcccaaggaaaggaccagatgtggtatgaggatgccttg
gctaccggccaccctatcatcctgtacctgcacggaaatgcaggcaccagaggaggtgac
caccgagtggagctttacaaggtgctgagttcccttggttaccacgtggtcacctttgac
tacagagggtggggagactcagtaggaacgccatcggagcgaggcatgacgtatgacgca
ctccatgtttttgactggatcaaagcaagaagtggagacaaccctgtatatatttggggt
cattccctaggcactggagtggcaacaaacctggtgcggcgcctctgtgagcgagagacg
cctcccgatgctcttatattggaatctccattcactaatatccgtgaagaagctaagagc
catccgttctcagtgatatatcgatacttccctgggtttgactggttcttcctcgacccc
attacaagcagtggaattaaatttgctaatgatgaaaatgtgaagcacatctcctgctcc
ctgctcatcctgcatgctgaggacgacccagttgtgcccttccagctcggcagaaagctc
tacaacatcgctgctccatctcgaagcttccgagacttcaaagttcagtttattcccttc
cactcagacctcggctacaggcacaagtatatctacaagagccctgagctcccacggata
ctgagggaattcctggggaagtcagaacctgggcgccagcactga

DBGET integrated database retrieval system