KEGG   Panthera tigris altaica (Amur tiger): 102954599
Entry
102954599         CDS       T02988                                 

Gene name
NPAS1
Definition
(RefSeq) neuronal PAS domain protein 1
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102954599 (NPAS1)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102954599 (NPAS1)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_4
Other DBs
NCBI-GeneID: 102954599
NCBI-ProteinID: XP_015395105
Position
Un
AA seq 439 aa
MWIWGRRDAFEGGQEDLLEEVTLQQSKFGLFPGQFVEMESHTPSHRGPVALVSEVFEQHL
GGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHSEVLEQL
GLRARPPGPPTPPSVPSSSSSSSSSSSLADTPEIGNSRGPKVTRPQGCRARCYKTHSPSS
CAEFCKMHQSLNQGNATWLPKSPSHRLSLSPPVLRVSDHMDLGPSELVGRSCYQFVHGQD
AARIRQSHLDLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAVSGKSPGERHVLWVSYVLR
RIRNVIGESSVGQHRSRPQMGRLRAGDAHPQCPLYLPLPEPEPPVEGKQAAPLDKDEPPR
TRGKRIKVEPGPGETKDPEDSAEEEPSSHPALPRPEFTSVIRAGALKQDLVRPWGLGPPG
DPPPSLLHAGFLPPVVRGL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtggatttggggccgcagggatgcttttgagggtggtcaggaggacctcttggaggag
gtgacgttgcagcagagcaaatttggcctgttccccggacagttcgtagaaatggaatca
cacacccccagccacaggggccccgtggcgctggtctccgaagtcttcgagcagcacctg
ggaggacacatcttgcagtccctggatggcttcgtgtttgccttgaaccaggaagggaaa
ttcctctacatttcagagaccgtctccatttatctgggtctctcacaggtggagctgacg
ggtagcagcgtcttcgactacgtccatcccggggaccactcggaagtgctagagcaactg
gggctccgggcccggcctcccgggccccccacgccgccctccgtcccctcctcctcctcc
tcctcctcgtcttcttcctcgcttgcagatactcctgagatcggtaattccaggggcccc
aaagtcacgcggcctcaagggtgtagggctcgttgttacaaaacccactctccttcgagt
tgcgcagagttttgcaaaatgcaccagagtctgaaccaaggcaacgcgacttggctcccg
aaaagcccttctcaccgcctctctctgtcgccccctgtgctcagagtcagcgaccacatg
gacctggggccctcagagcttgtgggccgcagctgctaccagtttgtccacggccaggac
gcagccaggatccgccaaagccacctggacctgctggacaagggtcaggtgatgaccggt
tactaccgttggctgcagcgagccgggggctttgtgtggctgcagtccgtggccaccgtg
gccgtgagcgggaagagccccggggagcgccacgtgctgtgggtcagctacgtgctcagg
aggatacggaacgtcatcggggaaagttctgttggacaacacaggtctagaccacagatg
ggaagactgagggctggggacgcgcacccgcagtgccctttgtatctccctcttccagag
ccagagcctccagtggaagggaagcaggctgcccccctagacaaggatgagccccctcgg
acccggggcaaacgcatcaaagtggagcctggcccgggggagaccaaagacccggaggac
agcgcagaggaggagccgtccagccacccggccctgccgaggcccgagtttacttccgtc
atccgggcaggggccctgaagcaggacctggtgcggccctggggcctggggcctcctgga
gaccccccaccgtccctcctccacgcgggcttcctgccccccgtcgtgcggggcctg

DBGET integrated database retrieval system