KEGG   Panthera tigris altaica (Amur tiger): 102954901
Entry
102954901         CDS       T02988                                 

Gene name
CLOCK
Definition
(RefSeq) clock circadian regulator
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04710  Circadian rhythm
ptg04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102954901 (CLOCK)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102954901 (CLOCK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102954901 (CLOCK)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102954901 (CLOCK)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102954901 (CLOCK)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102954901 (CLOCK)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102954901 (CLOCK)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 102954901
NCBI-ProteinID: XP_007075941
Position
Un
AA seq 844 aa
MLFTVSCSKMSSIVDREDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESITSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGTIRRT
HRPSYDDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPAHEKMAPRRSSF
SSQSINSQSVGQSLTQPVMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSTPGLNFGSVQLSSGNSSNIQQLAPISMQGQ
VVQTNQIQSGMNTGHIGTTQHMIQQQTLQSTSSQQSQQNVLSGHSQQTSLPSQTQSTLTT
PLYNTMVISQPAAGSMVQIPSSMPQNSTQSTAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSTMLMGQVVTAYPTFATQQQQPQALPATQQQNSQEQPLASVQQPSQAPLTQPP
QQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLNRHRTDSLTDPSK
VQPQ
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgtcgacagagaagatggtagt
atatttgatgggttggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctaggaagatggacaaatctactgttctgcagaagagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgccagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagaatttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtataacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
acccctgaatatttaaaatcaaaaaatcagttagaattctgttgtcatatgcttcgagga
acaatagacccaaaggagccatctacctatgaatatgtgaaatttataggaaatttcaaa
tctttaaacagtgtatcgacttcagcacacaatggttttgaaggaactatacgacgcaca
cacaggccttcttatgatgatagagtttgttttgtagccactgtcagattagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacctaatgaagagtttacatccagacat
agtttagaatggaagttcctatttctagatcacagggcaccacctataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaac
ttggcaaaatgccatgagcacttaatgcagtacgggaaaggcaaatcatgttattataga
ttcctcaccaagggacaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattctaggccagaatttattgtttgtactcacaccgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgataatcgtataaacacagtcagtctcaaagaagcc
ttggaaaggtttgatcacagcccaactccttctgcttcctcccggagttcaagaaaatca
tctcacacagcagtctcagacccttcctcaacaccaacaaagatcccaacagatactagc
actcctcccagaccgcatttaccagctcatgaaaagatggcaccaaggaggtcatcattt
agtagtcagtccataaattcccagtctgttggtcagtcattaacacaaccagtgatgtct
caagctgcaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcagtta
ggagccatgcagcatctaaaagaccagttagagcaacggacacggatgatagaggcaaac
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcaaatggtccatggt
caagggctgcagatgtttttacagcagtcaacccctggtttgaattttggttctgttcaa
ctttcttctggaaattcatctaacatccagcaacttgcacctataagtatgcagggccag
gtcgttcaaaccaaccaaattcagagtggaatgaatactggacacattggcacaactcag
catatgatacaacagcagactttacaaagtacatcaagtcagcagagtcaacaaaatgta
ctgagtgggcacagtcaacaaacctcgcttcctagtcagacacagagcacactcaccact
ccgctctataacactatggtgatctcacagccggcagctggaagcatggtccagattcca
tctagcatgccacagaacagtacccagagcactgctgtaactacattcactcaggacaga
cagatcagattttctcaaggtcagcagcttgtgaccaaattagtaactgctcctgtagct
tgtggggcggtcatggtacccagcacaatgctcatggggcaggtggtgactgcctaccct
acgtttgctacccagcagcagcagccacaggcactgccagccacacagcagcagaactcc
caggaacagccgcttgcttcagttcagcaaccttctcaggctccgctgacccaaccacca
cagcagtttttacagacttcaaggttgctccacgggaatccttcgactcagcttatcctc
tctgctgcatttccactacaacagagcactttccctcagtcacatcaccagcagcaccag
tctcagcaacagcagcaactgaatcggcacaggactgacagtttgaccgatccttccaag
gttcaaccacagtag

DBGET integrated database retrieval system