KEGG   Panthera tigris altaica (Amur tiger): 102955166
Entry
102955166         CDS       T02988                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00100  Steroid biosynthesis
ptg01100  Metabolic pathways
Module
ptg_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102955166 (TM7SF2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102955166 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102955166
NCBI-ProteinID: XP_007092137
Position
Un
AA seq 347 aa
TLPPYRVPLCLQVAEGLELKDKSRLRYPINGFQALVLTALLVGLAVSAGLPLGALPEMLV
PLAFAATLTALIFSFLLYLKALGVPPSALAPGGTSGNPIYDFFLGRELNPRICSFDFKYF
CELRPGLIGWVLINLALLIQEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDIT
HDGFGFMLAFGDLAWVPFTYSLQAQFLLHHPQPLGLPMASAICLINALGYYIFRRANSQK
NTFRKNPSDPRVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLL
PYFYFLYFTALLVHREARDEQQCLQKYGLAWQEYCRRVPYRILPYVY
NT seq 1044 nt   +upstreamnt  +downstreamnt
acactccccccttacagagtccctttgtgcctgcaggtggccgaggggctggaattgaag
gacaagagtcgcctgcgctaccccattaacggcttccaggccctggtgctgacggccctg
ttggtgggcttggcagtgtccgcggggctgcctctgggggcgcttccggaaatgctcgtg
cccttggcgtttgcggccaccctcaccgccttaatcttcagcttccttctctacctgaag
gctctgggagtccctccctccgccctggcacctggggggacctcaggcaaccccatctac
gactttttcctgggacgggagctcaacccgcgcatctgttcctttgacttcaaatatttc
tgtgaactgcggcctggcctcatcggctgggtcctcatcaacctggccctgctgattcag
gaagcggaacttcgggggagtccctcactggccatgtggctggtcaacggcttccagcta
ctctatgtgggtgatgctctctggcatgaggaggctgttctcaccaccatggacatcacg
cacgacgggtttggcttcatgctggcctttggggacctggcctgggtacccttcacttac
agcctgcaggcccaatttttgctgcaccacccgcagcccctggggttgcccatggcctcc
gccatctgtctcatcaacgctcttggttactacatcttccgaagagccaattcccagaag
aacaccttccggaagaatccttctgaccccagagtggctggcctcgagaccatccccacg
gccacggggcggcagctgctggtgtccgggtggtggggtatggtccgccaccccaactac
ctcggggacctcatcatggctctggcgtggtccttgccctgcggggtgtctcacctgctg
ccctatttctacttcctctacttcacggcgctcctggtgcaccgggaggcccgggatgaa
cagcagtgcctacagaagtacggcctggcctggcaggagtactgccggcgcgtgccttac
cgaatcctgccctacgtctactga

DBGET integrated database retrieval system